MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Casein kinase 2 is essential for mitophagy. Casein kinase 2 is essential for mitophagy. EMBO Rep. (1469-221X) 2013 imex curation Kanki T., Kurihara Y., Jin X., Goda T., Ono Y., Aihara M., Hirota Y., Saigusa T., Aoki Y., Uchiumi T., Kang D. kanki@med.niigata-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Kanki T., Kurihara Y., Jin X., Goda T., Ono Y., Aihara M., Hirota Y., Saigusa T., Aoki Y., Uchiumi T., Kang D. kanki@med.niigata-u.ac.jp Accepted 2013-DEC-03 by LUANA EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation Casein kinase 2 is essential for mitophagy. Casein kinase 2 is essential for mitophagy. EMBO Rep. (1469-221X) 2013 imex curation Kanki T., Kurihara Y., Jin X., Goda T., Ono Y., Aihara M., Hirota Y., Saigusa T., Aoki Y., Uchiumi T., Kang D. kanki@med.niigata-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Kanki T., Kurihara Y., Jin X., Goda T., Ono Y., Aihara M., Hirota Y., Saigusa T., Aoki Y., Uchiumi T., Kang D. kanki@med.niigata-u.ac.jp Accepted 2013-DEC-03 by LUANA EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation csk21_yeast Casein kinase II subunit alpha YIL035C CKA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKCRVWSEARVYTNINKQRTEEYWDYENTVIDWSTNTKDYEIENKVGRGKYSEVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKVPPTTLPFQKDQYYTNQKEDVLKFIRPYIFDQPHNGHANIIHLFDIIKDPISKTPALVFEYVDNVDFRILYPKLTDLEIRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGTSDFEKYLLKYEITLPREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQERLTAKEAMGHPWFAPIREQIEK 6A1A7F1BF47250C9 6A1A7F1BF47250C9 atg32_yeast Autophagy-related protein 32 YIL146C ATG32 Extracellular mutant protein 37 ECM17 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL DB6A3DAFD50FB619 csk2b_yeast Casein kinase II subunit beta CKB1 YGL019W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEAVSGPRMKWLRQYPSTEEDWEEFAKCEFETPAV 9ACA8D285E6990AF 9ACA8D285E6990AF atg11_yeast Autophagy-related protein 11 Cytoplasm to vacuole targeting protein 9 ATG11 CVT9 YPR049C YP9499.07c protein protein yeast Saccharomyces cerevisiae Baker's yeast MADADEYSTAPTQQEITPLQTTATIINAISGECITTNVDFFVSLDKFKQFIARKWKIPPDQLLILLPYGNKLKPSMFKELLINRSFTLNDFYVYDRRLFSLVSKPTPTNLLTSKDSNPMNSPNSNDLTETLEYLIKNSHISQYQGSDTIMIKPMPSPLEDADVDLSRLNYHSVTSLLTTNLGWLSALEIDVHYFKSLIPDIIAHIKRIFDGLTVCSQYLKLYCFDVESLYNSNVQFLNQLVDNGMTSKWEKCFNDTLSKLTALEGDSLQKFINIESLLENEKSVKILNHSINGKLNKIKREIDENASFRDIITVNIDRLRQMFTPNESKFELEDQMAESFEVLVSEMRTRSRNVLDKEEEEFNSQEFLKSMNVMLEKDKKESVKTLFTISQALYSQIGELIDLKKSLQKHAVAILGNIAFTQMEILGIKRLLLNECNKDLELYKKYEVEFAQVEDLPLIYGLYLIEKYRRLSWFQQILSFISNFNQDLELFKQNELRTRNKWVKNFGSIATVFCEDLLSSSDFKRLNEYHSHTSPPNEDEEDENENSIANYRQDLVKVSQAIDNYMTQIKETDVSEPIIDLLSKTLFETKRFHIIYSNFKNNNNNSSNGNSISPEGSIALKSDDVVKGYKTRIKKLESLLHEFQYSDIGHWPQGVLNTHLKPFRGSATSINKKKFLGASVLLEPANISEVNIDSVSQANNHQIQELESNVDDLLHQLQLLKEENNRKSMQISEMGKKISDLEVEKTAYRETLTNLNQELARLTNEEQSHRTEIFTLNASFKKQLNDIISQDNEKIEKLTGDYDDVSKSRERLQMDLDESNKKHEQEVNLLKADIERLGKQIVTSEKSYAETNSSSMEKGEKFETIPLAEDPGRENQISAYTQTLQDRIFDIISTNIFILENIGLLLTFDNNNNIQIRRVKGLKKGTAQSNILDESTQMLDAHDNSLIKSPVFQKLKDEYELIKSVANGSEKDTQQSIFLGNITQLYDNKLYEVAVIRRFKDIETLAKKLTKENKIKRTLLERFQREKVTLRNFQIGDLALFLPTRENVNSVGSMSSSTSSLSSSFSSVDLSTPPPLDAMSIQSSPSVIHSNVINQASISGRDKNKLMRPWAAFTAFEESTRYFLKDEKGLTKGKEWFVGRIVTLEHFVADSPSNNPFRLPKGSVWFQVTAVVVSYQGV A904B92E9AE79449 A904B92E9AE79449 atg32-cka1 1 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell proteina tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4d sf8b sf8c we expressed ProA only (negative control) or ProA-Atg32 and HA-Cka1 in WT cells and performed protein A affinity isolation. Although HA-Cka1 barely co-precipitated with ProA-Atg32 when cultured in synthetic minimal medium with glucose (SMD), HA-Cka1 co-precipitated with ProA-Atg32 after nitrogen starvation (Fig 4D, SD-N). Similarly, HA-Ckb1 also co-precipitated with ProA-Atg32 during nitrogen starvation (supplementary Fig S8A online). This Atg32–CK2 interaction was not affected by Atg32-2SA mutation (supplementary Fig S8B online). atg32-cka1-1 1 5 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell proteina tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf8a we expressed ProA only (negative control) or ProA-Atg32 and HA-Cka1 in WT cells and performed protein A affinity isolation. Although HA-Cka1 barely co-precipitated with ProA-Atg32 when cultured in synthetic minimal medium with glucose (SMD), HA-Cka1 co-precipitated with ProA-Atg32 after nitrogen starvation (Fig 4D, SD-N). Similarly, HA-Ckb1 also co-precipitated with ProA-Atg32 during nitrogen starvation (supplementary Fig S8A online). This Atg32–CK2 interaction was not affected by Atg32-2SA mutation (supplementary Fig S8B online). atg32-cka1-2 1 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell proteina tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf5a sf5b we expressed ProA only (negative control) or ProA-Atg32 and HA-Cka1 in WT cells and performed protein A affinity isolation. Although HA-Cka1 barely co-precipitated with ProA-Atg32 when cultured in synthetic minimal medium with glucose (SMD), HA-Cka1 co-precipitated with ProA-Atg32 after nitrogen starvation (Fig 4D, SD-N). Similarly, HA-Ckb1 also co-precipitated with ProA-Atg32 during nitrogen starvation (supplementary Fig S8A online). This Atg32–CK2 interaction was not affected by Atg32-2SA mutation (supplementary Fig S8B online). atg32-cka1-3 2 3 autoradiography autoradiography autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified 4 autoradiography autoradiography autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phosphorylation phosphorylation reaction phosphorylation sf7c