UniProt UniProt http://www.uniprot.org Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. Not possible to curate interaction with RAB8 since species is unknown. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation Novel interaction of Rab13 and Rab8 with endospanins. Novel interaction of Rab13 and Rab8 with endospanins. FEBS Open Bio 2013 mimix curation Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi 09-Sep-2013: Contacted by IntAct-Help. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi Accepted 2013-AUG-29 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. FEBS Open Bio 2013 mimix curation rab13_rat Ras-related protein Rab-13 Rab13 protein protein rat Rattus norvegicus (Rat) Rat MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQREQAERLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGNSSKPSSTDLKVSDKKNSNKCSLG B6687462C6EA95A4 lerl1_rat Leptin receptor overlapping transcript-like 1 Endospanin-2 Leprotl1 protein protein rat Rattus norvegicus (Rat) Rat MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGVVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW EB099668DC441D35 obrg_rat Leptin receptor gene-related protein Endospanin-1 Leprot Lepr Obr OB-R gene-related protein protein protein rat Rattus norvegicus (Rat) Rat MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW 58EBEC50B01DEA81 rab13_human Ras-related protein Rab-13 RAB13 GIG4 Cell growth-inhibiting gene 4 protein protein protein human Homo sapiens Human MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG DIP protein P51153 original sequence version: 133 141621CB998178DA rab13-leprotl1 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association not shown rab13-leprotl1-1 4 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association fig 1A leprotl1-rab13 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction fig 1C leprot-rab13 2 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait direct interaction direct interaction fig 1C leprotl1-rab13-1 3 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association fig 1F leprot-rab13-1 6 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association fig 1D leprotl1-rab13-2 6 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association fig 1D rab13-leprotl1-2 7 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 2A leprotl1-rab13-3 5 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 2C