MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. FEBS Lett. (0014-5793) 2013 Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. FEBS Lett. (0014-5793) 2013 Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. FEBS Lett. (0014-5793) 2013 Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. FEBS Lett. (0014-5793) 2013 dyi2_chlre Dynein, 78 kDa intermediate chain, flagellar outer arm ODA9 ODA-9 IC78 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPALSPAKKGTDKGKTGKKTGKQEQNAQDYIPPPPPMPGDEAFAMPIREIVKPDNQLWLSEADLNEEVAKMLTANNPAAPKNIVRFNMKDKVFKLEPMVEQTVVHYATDGWLLHKSSDEAKRQMDMEKMEQEASARFQADIDRASHEHKDHGDVEPPDDSRQLRNQFNFSERAAQTLNYPLRDRETFTEPPPTATVSGACTQWEIYDEYIKDLERQRIDEAMKSKGGKKAAAAARAAGAAHRQRNEHVPTLQSPTLMHSLGTLDRMVNQNMYEEVAMDFKYWDDASDAFRPGEGSLLPLWRFVSDKSKRRQVTSVCWNPLYDDMFAVGYGSYEFLKQASGLINIYSLKNPSHPEYTFHTESGVMCVHFHPEFANLLAVGCYDGSVLVYDVRLKKDEPIYQASVRTGKLNDPVWQIYWQPDDAQKSLQFVSISSDGAVNLWTLTKSELIPECLMKLRVVRAGETREEEDPNASGAAGGCCMDFCKMPGQESIYLVGTEEGAIHRCSKAYSSQYLSTYVSHHLAVYAVHWNNIHPSMFLSASCRLDHQAVGLCHDPKRAVMNFDLNDSIGDVSWAALQPTVFAAVTDDGRVHVFDLAQNKLLPLCSQKVVKKAKLTKLVFNPKHPIVLVGDDKGCVTSLKLSPNLRITSKPEKGQKFEDLEVAKLDGVVEIARKSDADLAKNAAH mint 13D4EE4EB9F461BD dyi3_chlre Dynein, 70 kDa intermediate chain, flagellar outer arm ODA6 IC70 ODA-6 IC69 IC70 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MEIYHQYIKLRKQFGRFPKFGDEGSEMLADIRPNEDHGKEYIPRNPVTTVTQCVPEMSEHEANTNAVILVNKAMSHVEGGWPKDVDYTEAEHTIRYRKKVEKDEDYIRTVVQLGSSVEDLIKQNNAVDIYQEYFTNVTMDHTSEAPHVKTVTVFKDPNNIKRSASYVNWHPDGSVPKVVVAYSILQFQQQPAGMPLSSYIWDVNNPNTPEYEMVPTSQICCAKFNLKDNNLVGAGQYNGQLAYFDVRKGNGPVEATPIDISHRDPIYDFAWLQSKTGTECMTVSTDGNVLWWDLRKMNECVENMPLKEKNSETTVGGVCLEYDTNAGPTNFMVGTEQGQIFSCNRKAKNPVDRVKYVLSGHHGPIYGLRRNPFNSKYFLSIGDWTARVWVEDTAVKTPILTTKYHPTYLTGGTWSPSRPGVFFTIKMDGAMDVWDLYYKHNEPTLTVQVSDLALTAFAVQESGGTVAVGTSDGCTSVLQLSTGLSEASPAEKANINAMFERETTREKNLEKAIKEAKVKARKEQGRRDEVKDNVTEEQLKALEDEFFKTTDPAVGGGYGAGEGAAAE F32D2BD11200665D oda1_chlre Outer dynein arm protein 1 ODA1 DCC2 Docking complex component 2 CHLREDRAFT_132719 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPSADATRGGGSAGSMGKGTLGAGDTLGHKSVLDKQRAAIEKLRAQNEQLKTELLLENKFSVRPGDPFAQALINRLQDEGDMLARKIVLEMRKTKMLDQQLSEMGSTLTTTRNNMGGIFSAKEQSTAVQKRIKLLENRLEKAYVKYNQSITHNKQLRESINNLRRERIMFESIQSNLERELAKLKRDMADMIQQANGAFEAREKAIGEMNALKAQADKEQQGFEEEWRQLTTIIEEDKKERERARAQELAMRERETQELLKMGTLSSAEKKKRITKGSWNVGYNKAMAQNVAAEKVEMYGQAFKRIQDATGIEDIDQLVNTFLAAEDQNYTLFNYVNEVNQEIEKLEDQINIMRGEINKYRETGRELDMTKSRELTEEEARLAASEAQSQLYEKRTDSALSMTTALKAGINDLFERIGCNTPAVRDLLGEEGVTEANLTAYLGIIEQRTNEILQIYAKRKAQQGTDGLAEALLAQPLTQPGNRIIIEPPSTTQEEEVEGLEPEPVEEDRPLTREHLESKVQRTLPRKLETAIKVRPAGADATGGKRGSPTRR mint 1C4CD4F2A3CAE862 a8ipz5_chlre CHLRE_17g703850v5 ODA3 CHLREDRAFT_189083 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAQKSTLKLPRLRTKEELLKTSPELCKLLGEDSDDGRSMSPFTAPPPAGTVKPPSRGLPAVSTKATKGPGMDTPRGLGEEELTEEELLRLELEKIKNERQVLLDSIKLVKAQAGTAGGEAQQNDIKALRRELELKKAKLNELHEDVRRKENVLNKQRDDTTDASRLTPGELSEEQAYIQQLQDEMKQIDEELVEAEAKNRLYYLLGERTRREHLAMDMKVRASQQLKKDSADDLYTLTAHFNEMRAAKEQAERELARMKRMLEETRVDWQKKLRERRREVRELKKRQQKQLERERKMREKQLERERQERELQAKLKMEQDSYEMRVAALAPKVEAMEHSWNRIRTISGADTPEEVLAYWEGLKAKEEQMRSLVSLAEQRESSAKSEIAALLENRSGMYEKGSAAAADVGEGSEERATLITEVERNMEGAKGKFNKLRSVCIGAEQGLRSLQERLMIALEEIHPDQLRASHMKGGHDAKARGKGAASAGARRGSAHAHTPDRNKRGPATGSRSQSPALVPHSPAGDKPSSPLHGTSPEHGHEPIPEGAEELAGEAEMVSPLGADGNTIDDEHFFPELPELLTSVTDRLNRVLVLAAELDAQEPAGAGEDGLPLSGEPGADGAEGAAPASPSRGAPEGLSESERTLVKGMNRRTWTGAPLLETINASPSEAALTLNIKRKKGKKKEQQVQPDLNRILGYTGSDVEEEEPESEEETEEEANKDDGVVDRDYIKLRALKMSQRLANQQRAIKV mint 6E2105339BF3ED00 oda6-oda9 2 IC1 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified direct interaction direct interaction f3a mint oda1-oda6 2 IC1 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC2 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f3B oda6-oda1-2 2 DC2 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint oda6-oda9-1 1 IC1 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint oda3-oda9 1 IC1 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint oda1-oda3 1 DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC2 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC1 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint oda1-oda3-1 1 DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC2 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint oda1-oda3-2 1 DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DC2 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint oda3-oda6 1 DC1 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IC2 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint