Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. Mol. Cancer 2013 imex curation Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer Species detail for eif3f obtained from authors. cher@wsu.edu Accepted 2014-FEB-19 by PPORRAS Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. Mol. Cancer 2013 imex curation Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer Species detail for eif3f obtained from authors. cher@wsu.edu Accepted 2014-FEB-19 by PPORRAS Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. Mol. Cancer 2013 imex curation Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu Accepted 2014-FEB-19 by PPORRAS Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair. Mol. Cancer 2013 imex curation Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chu Y.L., Wu X., Xu Y., Her C. Cancer - Interactions investigated in the context of cancer cher@wsu.edu Accepted 2014-FEB-19 by PPORRAS Human ovary cDNA library Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL DIP protein O00303 original sequence version: 142 DIP protein O00303 original sequence version: 80 DIP protein O00303 original sequence version: 95 DIP protein O00303 original sequence version: 126 8A70FC6E2BF07737 msh4_human MutS protein homolog 4 MSH4 protein protein human Homo sapiens Human MLRPEISSTSPSAPAVSPSSGETRSPQGPRYNFGLQETPQSRPSVQVVSASTCPGTSGAAGDRSSSSSSLPCPAPNSRPAQGSYFGNKRAYAENTVASNFTFGASSSSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSVIVAVVEGRGLARGEIGMASIDLKNPQIILSQFADNTTYAKVITKLKILSPLEIIMSNTACAVGNSTKLFTLITENFKNVNFTTIQRKYFNETKGLEYIEQLCIAEFSTVLMEVQSKYYCLAAVAALLKYVEFIQNSVYAPKSLKICFQGSEQTAMIDSSSAQNLELLINNQDYRNNHTLFGVLNYTKTPGGSRRLRSNILEPLVDIETINMRLDCVQELLQDEELFFGLQSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITNLIYLKHTLELVDPLKIAMKNCNTPLLRAYYGSLEDKRFGIILEKIKTVINDDARYMKGCLNMRTQKCYAVRSNINEFLDIARRTYTEIVDDIAGMISQLGEKYSLPLRTSFSSARGFFIQMTTDCIALPSDQLPSEFIKISKVKNSYSFTSADLIKMNERCQESLREIYHMTYMIVCKLLSEIYEHIHCLYKLSDTVSMLDMLLSFAHACTLSDYVRPEFTDTLAIKQGWHPILEKISAEKPIANNTYVTEGSNFLIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVENMHFEVQHVKNTSRNKEAILYTYKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE 5A82684379346441 msh4-eif3f 3 5 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1a msh4-eif3f-1 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1b eif3f-msh4 1 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain range range physical association physical association 1b, c eif3f-msh4-1 2 5 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1d msh4-eif3f-2 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association eif3f-msh4-2 3 5 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region gal galactosylated residue Gal deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gal4 ad gal4 activation domain gal4 ad predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1a