MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. EMBO J. (0261-4189) 2013 imex curation Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de Accepted 2014-FEB-03 by LUANA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. EMBO J. (0261-4189) 2013 imex curation Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de Accepted 2014-FEB-03 by LUANA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. EMBO J. (0261-4189) 2013 imex curation Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de Accepted 2014-FEB-03 by LUANA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation pder_ecoli Cyclic di-GMP phosphodiesterase PdeR pdeR gmr yciR JW1278 b1285 protein protein ecoli Escherichia coli (strain K12) MKTVRESTTLYNFLGSHNPYWRLTESSDVLRFSTTETTEPDRTLQLSAEQAARIREMTVITSSLMMSLTVDESDLSVHLVGRKINKREWAGNASAWHDTPAVARDLSHGLSFAEQVVSEAHSAIVILDSRGNIQRFNRLCEDYTGLKEHDVIGQSVFKLFMSRREAAASRRNNRVFFRSGNAYEVELWIPTCKGQRLFLFRNKFVHSGSGKNEIFLICSGTDITEERRAQERLRILANTDSITGLPNRNAMQDLIDHAINHADNNKVGVVYLDLDNFKKVNDAYGHLFGDQLLRDVSLAILSCLEHDQVLARPGGDEFLVLASNTSQSALEAMASRILTRLRLPFRIGLIEVYTSCSVGIALSPEHGSDSTAIIRHADTAMYTAKEGGRGQFCVFTPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITWRGEVRSLEALVRWQSPERGLIPPLDFISYAEESGLIVPLGRWVILDVVRQVAKWRDKGINLRVAVNISARQLADQTIFTALKQVLQELNFEYCPIDVELTESCLIENDELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQVFVRDIHKQPVSQSLVRAIVAVAQALNLQVIAEGVESAKEDAFLTKNGINERQGFLFAKPMPAVAFERWYKRYLKRA DIP protein P77334 original sequence version: null 991D47CDE46A8F01 mlra_ecoli HTH-type transcriptional regulator MlrA yehV MerR-like regulator A mlrA b2127 JW2115 protein protein ecoli Escherichia coli (strain K12) MALYTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWIDNGVQVSKVKMLLSNENVDVQNGWRDQQETLLTYLQSGNLHSLRTWIKERGQDYPAQTLTTHLFIPLRRRLQCQQPTLQALLAILDGVLINYIAICLASARKKQGKDALVVGWNIQDTTRLWLEGWIASQQGWRIDVLAHSLNQLRPELFEGRTLLVWCGENRTSAQQQQLTSWQEQGHDIFPLGI 48F6D16051C04319 dgcm_ecoli Diguanylate cyclase DgcM dgcM ydaM JW5206 b1341 protein protein ecoli Escherichia coli (strain K12) MITHNFNTLDLLTSPVWIVSPFEEQLIYANSAAKLLMQDLTFSQLRTGPYSVSSQKELPKYLSDLQNQHDIIEILTVQRKEEETALSCRLVLRKLTETEPVIIFEGIEAPATLGLKASRSANYQRKKQGFYARFFLTNSAPMLLIDPSRDGQIVDANLAALNFYGYNHETMCQKHTWEINMLGRRVMPIMHEISHLPGGHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKRLEEQLEHAAHHDAMTGLLNRRQFYHITEPGQMQHLAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTLESCARKGDLVFRWGGEEFVLLLPRTPLDTALSLAETIRVSVAKVSISGLPRFTVSIGVAHHEGNESIDELFKRVDDALYRAKNDGRNRVLAA DIP protein P77302 original sequence version: null 19FE87B41C540B62 gmr-ydam-1 2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gmr-ydam-2 2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gmr-ydam-3 2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gmr-ydam-4 2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gmr-mlra 2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). gmr-mlra-1 2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). ydam-mlra 2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3 Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). gmr-ydam-5 3 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mlra-gmr-1 3 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mlra-gmr 3 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 ydam-1 1 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf4 ydam-1 1 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf4b