IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. Cell (0092-8674) 2013 imex curation Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. no A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk Accepted 2014-MAY-16 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. Cell (0092-8674) 2013 imex curation Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. no A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk Accepted 2014-MAY-16 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. Cell (0092-8674) 2013 imex curation Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk Accepted 2014-MAY-16 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. RAS and RHO families of GTPases directly regulate distinct phosphoinositide 3-kinase isoforms. Cell (0092-8674) 2013 imex curation Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fritsch R., de Krijger I., Fritsch K., George R., Reason B., Kumar M.S., Diefenbacher M., Stamp G., Downward J. no A phosphatidylinositol 3-kinase regulatory p85 subunit was present in all experiments bt not shown to be part of the interaction and could not be mapped to a single gene product. Interactions involving the p85 antibody also could not be captured as this will bind to the alpha and beta proteins. julian.downward@cancer.org.uk Accepted 2014-MAY-16 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation elmo1_human Engulfment and cell motility protein 1 ELMO1 KIAA0281 Protein ced-12 homolog protein protein human Homo sapiens Human MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELTKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN 053DCA73D2B0A4C6 pk3cg_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform p120-PI3K Pik3cg Pi3kg1 Phosphoinositide-3-kinase catalytic gamma polypeptide Serine/threonine protein kinase PIK3CG Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma protein protein mouse Mus musculus Mouse MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFIVIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNISESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKAQLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGSSGKKTSPHFQKFQDVCVRAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA DIP protein Q9JHG7 original sequence version: 78 DIP protein Q9JHG7 original sequence version: 107 7675848792D76734 rras_mouse Ras-related protein R-Ras Rras p23 protein protein mouse Mus musculus Mouse MSSGAASGTGRGRPRGGGPGPRDPPPGETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASSFSASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL mint Regulates the organization of the actin cytoskeleton C1D32CE7904322E5 rasn_human GTPase NRas Transforming protein N-Ras NRAS HRAS1 protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM DIP protein P01111 original sequence version: 105 DIP protein P01111 original sequence version: 131 DIP protein P01111 original sequence version: 135 DIP protein P01111 original sequence version: 138 6898D3F6815B1EC7 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rasn_mouse GTPase NRas Transforming protein N-Ras Nras protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRLKKLNSSDDGTQGCMGSPCVLM 688D33F6814855B7 cdc42_mouse Cell division control protein 42 homolog Cdc42 G25K GTP-binding protein protein protein mouse Mus musculus Mouse MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60766 original sequence version: 61 51A437E22A4D8FFF rask_human GTPase KRas KRAS RASK2 KRAS2 K-Ras 2 Ki-Ras c-K-ras c-Ki-ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 973547B2E11C2C81 rash_mouse GTPase HRas Hras H-Ras-1 Hras1 Transforming protein p21 c-H-ras p21ras protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein Q61411 original sequence version: 91 EE6DC2D933E2856A rase_mouse GTPase ERas Eras Embryonic stem cell-expressed Ras protein protein mouse Mus musculus Mouse MALPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGVGKSALTIQMTHQCFVKDHDPTIQDSYWKEVARDNGGYILNVLDTSGQDIHRALRDQCLASGDGVLGVFALDDPSSLDQLQQIWSTWTPHHKQPLVLVGNKCDLVTTAGDAHAAAALLAHKLGAPLVKTSAKTRQGVEEAFALLVHEIQRAQEAVAESSKKTRHQKAVCSCGCSVA 0F0EC10163027FCE rhog_mouse Rho-related GTP-binding protein RhoG Rhog Arhg Sid10750 Sid 10750 protein protein mouse Mus musculus Mouse MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL mint 0C4FE9C54140F499 rask_mouse GTPase KRas K-Ras 2 Ki-Ras c-K-ras c-Ki-ras Kras Kras2 protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIM DIP protein P32883 original sequence version: 102 97345422E01D2C81 pk3cb_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform Pik3cb Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta protein protein mouse Mus musculus Mouse MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAEKLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWIDWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTEETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS DIP protein Q8BTI9 original sequence version: 89 DIP protein Q8BTI9 original sequence version: 90 DIP protein Q8BTI9 original sequence version: 69 EBDF0266BF0A2032 pk3cd_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform Pik3cd Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta protein protein mouse Mus musculus Mouse MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEELQLREILERRGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ DIP protein O35904 original sequence version: 90 AD8DE07D8F847795 rac1_mouse Ras-related C3 botulinum toxin substrate 1 Rac1 p21-Rac1 protein protein mouse Mus musculus Mouse MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63001 original sequence version: 125 ACEDF83A45E5EA67 pk3ca_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphoinositide-3-kinase catalytic alpha polypeptide Serine/threonine protein kinase PIK3CA Pik3ca Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha protein protein mouse Mus musculus Mouse MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN DIP protein P42337 original sequence version: 123 D593283B416ABFD0 dira2_mouse GTP-binding protein Di-Ras2 Distinct subgroup of the Ras family member 2 Diras2 protein protein mouse Mus musculus Mouse MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPNREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVVM C1A69D3145C3EACD dira1_mouse GTP-binding protein Di-Ras1 Diras1 Gbts1 Distinct subgroup of the Ras family member 1 Small GTP-binding tumor suppressor 1 protein protein mouse Mus musculus Mouse MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLDELSPIYKLIVQIKGSVEDIPIMLVGNKCDETQREVHTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRSVSLSVDGKRSSKQKRADRIKGKCALM 2033DE94B27A5B9D rasm_mouse Ras-related protein M-Ras Ras-related protein R-Ras3 Muscle and microspikes Ras X-Ras Mras Xras protein protein mouse Mus musculus Mouse MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL 975CFDD1FDF37FCF rras2_mouse Ras-related protein R-Ras2 Rras2 protein protein mouse Mus musculus Mouse MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion mint BA7D4759DC49446F rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein P01112 original sequence version: 91 DIP protein P01112 original sequence version: 106 DIP protein P01112 original sequence version: 144 DIP protein P01112 original sequence version: 118 DIP protein P01112 original sequence version: 143 DIP protein P01112 original sequence version: 152 DIP protein P01112-1 original sequence version: 159 DIP protein P01112 original sequence version: 170 DIP protein P01112-1 original sequence version: 185 DIP protein P01112 original sequence version: 192 DIP protein P01112-1 original sequence version: 196 DIP protein P01112-1 original sequence version: 202 EE6DC2D933E2856A gbb2_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 Gnb2 Transducin beta chain 2 G protein subunit beta-2 protein protein mouse Mus musculus Mouse MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 5D08FFA240ADEEE6 hras1-pik3ca 2 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:19:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 16:32:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q61411:p.Asp33Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D I Wed May 02 15:23:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp33ile' Tue Jun 30 16:55:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp33Ile' ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1A, 2A, Supp Fig. 1D, 2A, 2F kras-pik3ca 2 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:08:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 17:48:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1A, 2A, Supp Fig. 1D nras-pik3ca 2 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:21:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 18:45:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1A, 2A, Supp. FIg. 1D pik3ca-hras1 2 20 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:57:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 17:27:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 25 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01112:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 19:23:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 20:18:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1B pik3ca-kras 2 20 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:10:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 19:14:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01116:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 16:01:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 17:33:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1B pik3ca-nras 2 20 unspecified role unspecified role bait bait P42337:p.[Thr208Asp;Lys227Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:26:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr208asp,lys227ala' Tue Jun 30 18:15:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr208Asp;Lys227Ala]' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01111:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:19:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 16:16:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 1B 1_phosphati-pik3cb-1 3 9 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 17 enzyme enzyme unspecified role unspecified role rbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:22:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 18:50:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig. 1F, 1G, 2C, 2G, 2H, 3B Gbeta-gamma subunits Gbeta-gamma subunits and platelet-derived growth factor receptor-derived phosphotyrosine peptide (pY740) Rac1 Cdc42 eras-pik3ca 2 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D rras-pik3ca 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D rras2-pik3ca 2 24 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D mras-pik3ca 2 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D diras1-pik3cb 2 22 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q91Z61:p.Ile37Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I D Wed May 02 20:31:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile37asp' Tue Jun 30 19:51:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile37Asp' ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 2A, Supp. Fig. 1C, 2A diras2-pik3cb 2 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 2A, Supp. Fig. 1C hras1-pik3cg 2 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, kras-pik3cg 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, nras-pik3cg 2 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, rras-pik3cg 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, rras2-pik3cg 2 24 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, rras2-pik3cd 2 24 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, rras-pik3cd 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, kras-pik3cd 2 18 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, nras-pik3cd 2 18 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, hras1-pik3cd 2 18 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association RAS proteins are GTP-gamma-S-loaded Fig. 2A, Supp Fig. 1D, rac1-pik3cb 2 19 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63001:p.Ile33Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I D Wed May 02 18:29:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile33asp' Tue Jun 30 20:24:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile33Asp' ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:38:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 20:11:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' Q8BTI9:p.Glu183Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:33:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183ala' Tue Jun 30 20:06:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Ala' Q8BTI9:p.Leu186Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:07:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu186ala' Tue Jun 30 16:11:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu186Ala' Q8BTI9:p.Val192Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V S Wed May 02 18:08:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val192ser' Tue Jun 30 17:12:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val192Ser' Q8BTI9:p.Ala194Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A S Wed May 02 19:19:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala194ser' Tue Jun 30 18:28:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala194Ser' Q8BTI9:p.Ala194Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A K Wed May 02 20:11:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala194lys' Tue Jun 30 16:17:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala194Lys' Q8BTI9:p.Val203Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V K Wed May 02 14:36:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val203lys' Tue Jun 30 18:47:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val203Lys' Q8BTI9:p.Gln207Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q D Wed May 02 17:14:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln207asp' Tue Jun 30 19:19:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln207Asp' Q8BTI9:p.Gln223Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q D Wed May 02 14:30:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln223asp' Tue Jun 30 20:10:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln223Asp' Q8BTI9:p.Tyr187Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:17:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr187ala' Tue Jun 30 16:36:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr187Ala' Q8BTI9:p.Lys190Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:36:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys190ala' Tue Jun 30 17:14:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys190Ala' Q8BTI9:p.Val192Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V K Wed May 02 18:05:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val192lys' Tue Jun 30 17:33:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val192Lys' Q8BTI9:p.Asp202Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:03:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp202ala' Tue Jun 30 20:09:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp202Ala' Q8BTI9:p.Val203Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V S Wed May 02 18:44:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val203ser' Tue Jun 30 17:13:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val203Ser' Q8BTI9:p.Glu219Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:00:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu219ala' Tue Jun 30 18:31:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu219Ala' Q8BTI9:p.Thr227Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T D Wed May 02 16:25:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr227asp' Tue Jun 30 19:34:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr227Asp' Q8BTI9:p.Lys185Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:37:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys185ala' Tue Jun 30 20:16:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys185Ala' Q8BTI9:p.Lys190Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:06:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys190ala' Tue Jun 30 19:43:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys190Ala' Q8BTI9:p.Arg229Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:26:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg229ala' Tue Jun 30 20:08:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg229Ala' Q8BTI9:p.Lys231Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:41:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys231ala' Tue Jun 30 15:40:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys231Ala' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Fig 2F, 3D Supp Fig. 2D, 3A, 3B Binding is GTP-dependent (GTP-gamma-S), p85 was also pulled down in this interaction but could not be mapped to a single gene product. cdc42-pik3cb 2 17 unspecified role unspecified role prey prey Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:30:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 17:30:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' Q8BTI9:p.Glu219Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:50:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu219ala' Tue Jun 30 17:56:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu219Ala' Q8BTI9:p.Thr227Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T D Wed May 02 18:04:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr227asp' Tue Jun 30 19:25:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr227Asp' Q8BTI9:p.Lys231Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:55:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys231ala' Tue Jun 30 16:13:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys231Ala' Q8BTI9:p.Glu183Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 14:38:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183ala' Tue Jun 30 19:44:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Ala' Q8BTI9:p.Lys185Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:07:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys185ala' Tue Jun 30 19:31:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys185Ala' Q8BTI9:p.Leu186Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:30:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu186ala' Tue Jun 30 20:05:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu186Ala' Q8BTI9:p.Tyr187Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:19:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr187ala' Tue Jun 30 18:09:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr187Ala' Q8BTI9:p.Lys190Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:22:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys190ala' Tue Jun 30 15:38:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys190Ala' Q8BTI9:p.Val192Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V S Wed May 02 19:27:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val192ser' Tue Jun 30 20:12:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val192Ser' Q8BTI9:p.Ala194Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A S Wed May 02 18:29:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala194ser' Tue Jun 30 17:00:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala194Ser' Q8BTI9:p.Arg229Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:35:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg229ala' Tue Jun 30 16:04:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg229Ala' Q8BTI9:p.Val192Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V K Wed May 02 16:31:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val192lys' Tue Jun 30 15:41:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val192Lys' Q8BTI9:p.Ala194Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A K Wed May 02 19:47:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala194lys' Tue Jun 30 18:12:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala194Lys' Q8BTI9:p.Asp202Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:59:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp202ala' Tue Jun 30 16:53:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp202Ala' Q8BTI9:p.Val203Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V S Wed May 02 16:09:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val203ser' Tue Jun 30 18:03:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val203Ser' Q8BTI9:p.Val203Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V K Wed May 02 20:29:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val203lys' Tue Jun 30 19:03:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val203Lys' Q8BTI9:p.Gln207Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q D Wed May 02 14:57:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln207asp' Tue Jun 30 19:11:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln207Asp' Q8BTI9:p.Gln223Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q D Wed May 02 16:50:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln223asp' Tue Jun 30 15:35:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln223Asp' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 2F Supp Fig. 2D, 3A, Binding is GTP dependent. p85 was also pulled down in this interaction but could not be mapped to a single gene product. rhog-pik3cb 2 15 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Supp Fig. 2D Binding is GTP dependent pik3cb-rac1 1 17 unspecified role unspecified role neutral component neutral component Q8BTI9:p.[Ser205Asp;Val244Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:55:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,val244ala' Tue Jun 30 16:39:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Val244Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 19 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3E, 3F, Supp Fig. 3C Interaction occurs in the presence of GTP-gamma-S cdc42-pik3cb-1 1 17 unspecified role unspecified role neutral component neutral component Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:15:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 18:48:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 11 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3E, 3F, Supp Fig. 3C Interaction occurs in the presence of GTP-gamma-S hras1-pik3cb 1 17 unspecified role unspecified role neutral component neutral component Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:19:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 16:17:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3F, Supp Fig. 3C Interaction occurs in the presence of GTP-gamma-S elmo1-gnb2 4 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Fig. 6E rhog-pik3cb-1 4 15 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 2E Binding is GTP dependent rac1-pik3cb-1 4 19 unspecified role unspecified role bait bait P63001:p.Ile33Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I D Wed May 02 18:06:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile33asp' Tue Jun 30 19:49:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile33Asp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:03:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 19:33:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig 3A/C, 2E, Supp 2E Binding is GTP-dependent (GTP-gamma-S), p85 was also pulled down in this interaction but could not be mapped to a single gene product. diras1-pik3cb-1 4 17 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q91Z61:p.Ile37Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I D Wed May 02 15:15:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile37asp' Tue Jun 30 17:07:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile37Asp' ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 2B cdc42-pik3cb-2 4 17 unspecified role unspecified role prey prey Q8BTI9:p.[Ser205Asp;Lys224Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:35:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205asp,lys224ala' Tue Jun 30 18:44:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser205Asp;Lys224Ala]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 2E, 3A/C Binding is GTP dependent. p85 was also pulled down in this interaction but could not be mapped to a single gene product.