MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CXCL14 is a natural inhibitor of the CXCL12-CXCR4 signaling axis. CXCL14 is a natural inhibitor of the CXCL12-CXCR4 signaling axis. FEBS Lett. (0014-5793) 2013 Tanegashima K., Suzuki K., Nakayama Y., Tsuji K., Shigenaga A., Otaka A., Hara T. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Tanegashima K., Suzuki K., Nakayama Y., Tsuji K., Shigenaga A., Otaka A., Hara T. FEBS Lett. (0014-5793) 2013 cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE DIP protein O95715 original sequence version: 128 C9A18B2A78CACF74 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 cxcr4-cxcl14 1 CXCR4 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait partially purified partially purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CXCL14 2 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified physical association physical association homomint mint f2b f2c 125I-CXCL14 was co-immunoprecipitated with CXCR4-FLAG or CXCR4v2-FLAG protein, and such interaction was abrogated in the presence of an excess amount of unlabeled CXCL14 (Fig. 2B). Moreover, complex formation between 125I-CXCL14 (1 nM) and CXCR4-FLAG or CXCR4v2-FLAG was specifically inhibited by 100 nM of CXCL14, but not by CXCL12, CCL2, or CXCL8 (Fig. 2C). Taken together, we concluded that CXCR4 is a specific and major binding component of the CXCL14 receptor.