MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. EMBO Rep. (1469-221X) 2013 imex curation Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn Accepted 2013-NOV-18 by LUANA 22-Nov-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. EMBO Rep. (1469-221X) 2013 imex curation Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn Accepted 2013-NOV-18 by LUANA 22-Nov-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation lgg1_caeel Protein lgg-1 lgg-1 atg-8.1 C32D5.9 protein protein caeel Caenorhabditis elegans MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE BC08727A3101875A q17740_caeel ain-1 C06G1.4 CELE_C06G1.4 protein protein caeel Caenorhabditis elegans MESLAKNFNNISIDDAAWHPNDQQPVWGNNGLQQQRVWAPPVPQPQFPNRSPWQQESNDIEPNVNEALVGLSGTGSSSQSQWGGIQNTDYEKQIWGDPPLSDVQYPLQPHASFGELNSLGGQSAPWSIGSQPAHPVWSNGGMGKESDDFWKQQQPQQHQQYPMPLLQGAWNTGMRHGPPGQGQRSGPMMQQQQDYQGGWGGPNNMGGNKQMNRPWGQDSNRGMSGMPPRNGRPNHNQGRYSGNMGGGVDVSVPPPMDMHMGGGMGGMRNMGVAPNSGHGSWKNNNAGGGQGGHGGQRNYNNRGGMGHSGSQSGGGSNMWNSTGNNGSGGSMQQFMGGDQQYNNPFPIGGAADDLTLTVWHDPNGELKKWQRDTGVSYWGDPEKQTDRTISLWIVGEGADEDLETALNRCPVPQKKGEDNQRFPFPVPAKRPIVVTGWGELPENDPNNPSKSESTIFDENNRWNDLTTEQNPWYLPNQHTSTFSSDNTTGSWVQGGTIPLNEPGTNQHVAVAEMLKNAVDKGYLDQSVTMMANLPPMVLQYVNMLLVKIPALDSVENELKQIIESSLPEDVKEVDPQNQQKYMNDSQKLEHNRLIIEVTTAKIEVQEYSKKVNRALMDAGIVQPQEQRAPASTEDYHYSFLE 2BE1655143A10010 lgg_1-ain_1 2 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4r ain_1-lgg_1 1 4 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f4s lgg_1-ain_1-1 1 3 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4t sf4d sf4e sf4f sf4g sf4h sf4i