IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. Cancer Cell (1535-6108) 2013 imex curation Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. Cancer Cell (1535-6108) 2013 imex curation Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. Cancer Cell (1535-6108) 2013 imex curation Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight by staining molecular weight estimation by staining weight by staining Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer Might there be a better Participant Detection method? I dont think "predetermined" is appropriate? Phosphorylated peptides were separated by electrophoresis (horizontal) and thin layer chromatography (vertical). The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. A NIK-IKKα Module Expands ErbB2-Induced Tumor-Initiating Cells by Stimulating Nuclear Export of p27/Kip1. Cancer Cell (1535-6108) 2013 imex curation Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay sequence tag sequence tag identification sequence tag Zhang W., Tan W., Wu X., Poustovoitov M., Strasner A., Li W., Borcherding N., Ghassemian M., Karin M. Cancer - Interactions investigated in the context of cancer The authors have stated that GST-IKKa, p27 and IkBa are of Human origin and have supplied details of constructs used. karinoffice@ucsd.edu Accepted 2013-JUL-08 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE DIP protein O15111 original sequence version: 91 DIP protein O15111 original sequence version: 123 DIP protein O15111 original sequence version: 133 DIP protein O15111 original sequence version: 118 DIP protein O15111 original sequence version: 125 DIP protein O15111 original sequence version: 96 4EA55C6FFC66FA16 cdkn1b-chuk 1 7 enzyme enzyme unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 enzyme target enzyme target substrate substrate unspecified role unspecified role P46527:p.Ser175Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:31:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser175ala' Tue Jun 30 19:47:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser175Ala' P46527:p.Ser178Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:32:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser178ala' Tue Jun 30 18:15:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser178Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4A, Supp 4E. Fig S4E enterered as Autoradiography -rather than antibody- for detection, as though no method is stated, the piccys look much more alike. cdkn1b-chuk-1 1 7 enzyme enzyme unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4Ai cdkn1b-chuk-2 2 7 enzyme enzyme unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46527:p.Ser175Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:26:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser175ala' Tue Jun 30 17:10:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser175Ala' P46527:p.Ser183Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:18:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser183ala' Tue Jun 30 15:42:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser183Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4F Whereas the S183A mutation had no effect on S175 phosphorylation, the S175A substitution increased S183 phosphorylation. cdkn1b-chuk-3 4 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phosphorylation phosphorylation reaction phosphorylation Supp 4B S12, T42, S175, S178 and S183, were found to be phosphorylated. cdkn1b-chuk-4 3 7 enzyme enzyme unspecified role unspecified role purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 enzyme target enzyme target substrate substrate unspecified role unspecified role P46527:p.Ser178Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:39:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser178ala' Tue Jun 30 16:49:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser178Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46527:p.Ser175Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:09:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser175ala' Tue Jun 30 17:08:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser175Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supp 4F.