IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomics (1615-9853) 2013 imex curation Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. GFP was detected by tag fluorescence. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Accepted 2013-AUG-09 by MGT 09-Sep-2013: Contacted by IntAct-Help. Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomics (1615-9853) 2013 imex curation Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Accepted 2013-AUG-09 by MGT 09-Sep-2013: Contacted by IntAct-Help. Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomics (1615-9853) 2013 imex curation Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Accepted 2013-AUG-09 by MGT 09-Sep-2013: Contacted by IntAct-Help. Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. Proteomics (1615-9853) 2013 imex curation Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Accepted 2013-AUG-09 by MGT 09-Sep-2013: Contacted by IntAct-Help. Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation prof1_mouse Profilin-1 Profilin I Pfn1 protein protein mouse Mus musculus Mouse MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY DIP protein P62962 original sequence version: 78 DIP protein P62962 original sequence version: 108 1DC8B60D545FF70E cbr1_human Carbonyl reductase [NADPH] 1 SDR21C1 Short chain dehydrogenase/reductase family 21C member 1 CBR1 CBR CRN NADPH-dependent carbonyl reductase 1 Prostaglandin-E(2) 9-reductase Prostaglandin 9-ketoreductase 15-hydroxyprostaglandin dehydrogenase [NADP(+)] 20-beta-hydroxysteroid dehydrogenase protein protein human Homo sapiens Human MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW DIP protein P16152 original sequence version: 148 51A5A495EB4F4EC3 prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY DIP protein P07737 original sequence version: 73 DIP protein P07737 original sequence version: 160 DIP protein P07737 original sequence version: 97 DIP protein P07737 original sequence version: 98 DIP protein P07737 original sequence version: 168 DIP protein P07737 original sequence version: 140 F725119E55A289EB esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 esr1-cbr1 3 6 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 7 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 8 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ligand binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 1b and supplementary table 1 pfn1-esr1 2 5 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association 4Aii Tamoxifen. pfn1-esr1-1 4 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4Bi Tamoxifen. esr1-pfn1 1 5 unspecified role unspecified role neutral component neutral component n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 4C Tamoxifen and E2.