MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. FEBS J. (1742-464X) 2013 Rahmanpour R., Bugg TD. suggested by lperfetto in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Rahmanpour R., Bugg TD. suggested by lperfetto FEBS J. (1742-464X) 2013 Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. FEBS J. (1742-464X) 2013 Rahmanpour R., Bugg TD. suggested by lperfetto in vitro In vitro bn-page blue native page bn-page experimental particp experimental participant identification experimental particp Rahmanpour R., Bugg TD. suggested by lperfetto FEBS J. (1742-464X) 2013 q0se23_rhojr RHA1_ro02408 protein protein rhosr Rhodococcus sp. (strain RHA1) MSDSSNLHRNLAPVTEVAWQQIGEEAARTFKRHVAGRRVVDVAGPFGYSYSAHNLGRVTPIKTSDSRIRAQQRQVNPLVELRFPFTLSRAEVDDVARGSLDSDWQPVKDAAKAVAFAEDQSIFQGFDEAGIRGLGPSSDNPVLSLPEDPLLIPDAVASALSALRLAGVEGPYSVVLDADAYTAVSETRDEGHPVFHHLRDLVAGDIIWAPAISGGYVLSTRGGDNQLTLGTDLSIGYDSHTATDVTLYLEETFTFASLTAEAAVVLAR mint 36C751765A52D86E q0se23 2 encapsulin 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction f3a mint Using purified R. jostii RHA1 encapulin nanocompartment, we have investigated methods to disassemble the nanocompartment, using native SDS-PAGE to monitor changes in native molecular weight. The native nanocompartment appears as a very high molecular weight band by native SDS-PAGE, as shown in Figure 3. Treatment with acetate buffer at pH 3 was found to give a low molecular weight band, eluting at approximately 60 kDa by native PAGE (see Figure 3A), consistent with a dimeric species. When the species obtained by treatment at pH 3.0 was subsequently incubated in 50 mM phosphate buffer pH 7.0 for 30 min, analysis by native PAGE revealed once again the high molecular weight band corresponding to reassembled nanocompartment. q0se23-q0se23 1 encapsulin 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified encapsulin 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3b mint