MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. EMBO J. (0261-4189) 2013 imex curation Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. EMBO J. (0261-4189) 2013 imex curation Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease. EMBO J. (0261-4189) 2013 imex curation Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study experimental particp experimental participant identification experimental particp Sharifi R., Morra R., Appel CD., Tallis M., Chioza B., Jankevicius G., Simpson MA., Matic I., Ozkan E., Golia B., Schellenberg MJ., Weston R., Williams JG., Rossi MN., Galehdari H., Krahn J., Wan A., Trembath RC., Crosby AH., Ahel D., Hay R., Ladurner AG., Timinszky G., Williams RS., Ahel I. suggested by lperfetto rsharifi@sgul.ac.uk EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B oard1_human ADP-ribose glycohydrolase OARD1 OARD1 C6orf130 O-acetyl-ADP-ribose deacetylase 1 TARG1 Terminal ADP-ribose protein glycohydrolase 1 [Protein ADP-ribosylglutamate] hydrolase OARD1 protein protein human Homo sapiens Human MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL mint homomint 8CC43CBDABA73E0B parg_human Poly(ADP-ribose) glycohydrolase PARG protein protein human Homo sapiens Human MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRVPPSSPACVPGRAGQHRGSATSLVFKQKTITSWMDTKGIKTAESESLDSKENNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTEKSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVTLVPEQFSNANIDRSPQNDDHSDTDSEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKSCDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEPESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDADIEFRKRYSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHFMRLPKAEDRRKEQWETKHQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANHTVTIRVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQTALLNKFTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKIALCLPNICTQPIPLLKQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIISRLFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT mint homomint D6646353C6D0180E par10_human Protein mono-ADP-ribosyltransferase PARP10 Poly [ADP-ribose] polymerase 10 ADP-ribosyltransferase diphtheria toxin-like 10 PARP10 protein protein human Homo sapiens Human MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPADAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPVQPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGDGASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSELSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRTGGLVTALQGAGTVTMGSGEEPGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVSSMPMGSLEHEGLVSLRPVGLQEQEGPMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCGAQASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLLGPEGQHLLQGLEAQFQCVFGTERLATATLDTGLEEVDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLATLEGLDLDGEDWLPRELEEEGPQEQPEEEVTPGHEEEEPVAPSTVAPRWLEEEAALQLALHRSLEPQGQVAEQEEAAALRQALTLSLLEQPPLEAEEPPDGGTDGKAQLVVHSAFEQDVEELDRALRAALEVHVQEETVGPWRRTLPAELRARLERCHGVSVALRGDCTILRGFGAHPARAARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAENTGEFQEVVRAFYDTLDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAHGFNRSFCGRNATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGLRAPPLRGPGHVLLRYDSAVDCICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPGRSPDT AC9CCFCF9B83A989 oard1-parp1 3 C6orf130 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q9Y530:p.Asp125Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:12:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:25:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp125ala' Tue Jun 30 16:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp125Ala' PARP1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction f2e homomint mint Analysis of the products of the C6orf130 reaction by thin-layer chromatography (TLC) revealed that C6orf130 released a product with a mobility aligned to the mono(ADP-ribose) marker (Figure 2E), suggesting that C6orf130 acts as an ADP-ribose hydrolase. C6orf130 similarly efficiently de(ADP-ribosyl)ates automodified PARP10, a PARP family member capable of only mono(ADP-ribosyl)ation (Kleine et al, 2008) (Figure 2G and H). parp1-2 3 PARP1 4 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp self self neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction true mint s d 1 oard1-parp1-1 3 C6orf130 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q9Y530:p.Lys84Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:12:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:20:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 17:33:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' PARP1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction f2e homomint mint Analysis of the products of the C6orf130 reaction by thin-layer chromatography (TLC) revealed that C6orf130 released a product with a mobility aligned to the mono(ADP-ribose) marker (Figure 2E), suggesting that C6orf130 acts as an ADP-ribose hydrolase. C6orf130 similarly efficiently de(ADP-ribosyl)ates automodified PARP10, a PARP family member capable of only mono(ADP-ribosyl)ation (Kleine et al, 2008) (Figure 2G and H). oard1-parp10 3 C6orf130 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q9Y530:p.Lys84Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:12:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:32:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84ala' Tue Jun 30 18:56:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Ala' PARP10 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction homomint mint f2g f2h Analysis of the products of the C6orf130 reaction by thin-layer chromatography (TLC) revealed that C6orf130 released a product with a mobility aligned to the mono(ADP-ribose) marker (Figure 2E), suggesting that C6orf130 acts as an ADP-ribose hydrolase. C6orf130 similarly efficiently de(ADP-ribosyl)ates automodified PARP10, a PARP family member capable of only mono(ADP-ribosyl)ation (Kleine et al, 2008) (Figure 2G and H). oard1-parp10-1 3 C6orf130 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q9Y530:p.Asp125Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:53:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Tue Jun 30 16:58:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp125Ala' PARP10 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction homomint mint f2g f2h Analysis of the products of the C6orf130 reaction by thin-layer chromatography (TLC) revealed that C6orf130 released a product with a mobility aligned to the mono(ADP-ribose) marker (Figure 2E), suggesting that C6orf130 acts as an ADP-ribose hydrolase. C6orf130 similarly efficiently de(ADP-ribosyl)ates automodified PARP10, a PARP family member capable of only mono(ADP-ribosyl)ation (Kleine et al, 2008) (Figure 2G and H). oard1-parp10-2 3 C6orf130 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified PARP10 7 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction homomint mint f2h Analysis of the products of the C6orf130 reaction by thin-layer chromatography (TLC) revealed that C6orf130 released a product with a mobility aligned to the mono(ADP-ribose) marker (Figure 2E), suggesting that C6orf130 acts as an ADP-ribose hydrolase. C6orf130 similarly efficiently de(ADP-ribosyl)ates automodified PARP10, a PARP family member capable of only mono(ADP-ribosyl)ation (Kleine et al, 2008) (Figure 2G and H). parp1-2 3 PARP1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp self self neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction true f3c mint Expectedly, PARP1 activity is greatly suppressed in these conditions, most likely due to the catalytic action of C6orf130 on mono- and poly(ADP-ribosyl)ated PARP1 species as the C6orf130 K84A mutant fails to block PARP1 automodification (Figure 3C). parg-parp1 3 PARG 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified PARP1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction f3b homomint mint oard1-parp1-3 1 C6orf130 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp enzyme enzyme bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y530:p.Gly123Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Tue Jul 12 10:09:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:27:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly123glu' Tue Jun 30 18:11:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly123Glu' PARP1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6a f6b f6c homomint mint oard1-parp1-3 1 C6orf130 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp enzyme enzyme bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y530:p.Lys84Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:19:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:16:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84ala' Tue Jun 30 19:44:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Ala' PARP1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6a f6b f6c homomint mint oard1-parp1-2 2 C6orf130 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q9Y530:p.Asp125Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:56:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:07:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp125ala' Tue Jun 30 16:08:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp125Ala' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PARP1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6e homomint mint