MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit. Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit. EMBO J. (0261-4189) 2013 imex curation Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A. Accepted 2013-JUN-27 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit. Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit. EMBO J. (0261-4189) 2013 imex curation Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A. Accepted 2013-JUN-27 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation dctn6_human Dynactin subunit 6 DCTN6 WS3 Dynactin subunit p27 Protein WS-3 protein protein human Homo sapiens Human MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN DIP protein O00399 original sequence version: null 7D0B12C0029C77B7 plk1_human Serine/threonine-protein kinase PLK1 Polo-like kinase 1 Serine/threonine-protein kinase 13 PLK1 PLK protein protein human Homo sapiens Human MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS DIP protein P53350 original sequence version: 169 DIP protein P53350 original sequence version: 170 DIP protein P53350 original sequence version: 164 DIP protein P53350 original sequence version: 154 DIP protein P53350 original sequence version: 91 DIP protein P53350 original sequence version: 145 DIP protein P53350 original sequence version: 121 DIP protein P53350 original sequence version: 118 DIP protein P53350 original sequence version: 123 DIP protein P53350 original sequence version: 119 DIP protein P53350 original sequence version: 138 DIP protein P53350 original sequence version: 163 DIP protein P53350 original sequence version: 178 178C2F13C10E8206 dctn5_mouse Dynactin subunit 5 Dctn5 Dynactin subunit p25 protein protein mouse Mus musculus Mouse MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV 476DAB4B7805D496 dctn6-2 2 p27 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction table 1, figure 4, figure 5 Rwork = 0.21 Rfree = 0.26 2.2 A plk1-dctn5 1 Plk1 4 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain p27 3 unspecified role unspecified role prey prey purified purified radiolabelled 32p radiolabel 32p radiolabel P32 32P 32P P32 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p25 5 unspecified role unspecified role prey prey radiolabelled 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association figure 3F