MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Conformation-specific crosslinking of mitochondrial complex I. Conformation-specific crosslinking of mitochondrial complex I. FEBS Lett. (0014-5793) 2013 Ciano M., Fuszard M., Heide H., Botting CH., Galkin A. in vitro In vitro crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Ciano M., Fuszard M., Heide H., Botting CH., Galkin A. FEBS Lett. (0014-5793) 2013 ndua9_bovin NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial NDUFA9 NADH-ubiquinone oxidoreductase 39 kDa subunit Complex I-39kD protein protein bovin Bos taurus (Bovine) Bovine MAAAVHPRVVRVLPMSRSSVPALAASVFHSPPQRQLHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRSKAVGEKEVRETFPEATIIKPAEIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPSRYLLFDLVQYVFAVAHRPFLPYPLPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDKILPHLPGLEDLGVEATPLELKAIEVLRRHRTYRWLSSEIEDVQPAKTIPTSGP B453FA19D48D03CD nu3m_bovin NADH-ubiquinone oxidoreductase chain 3 MT-ND3 MTND3 NADH3 ND3 NADH dehydrogenase subunit 3 protein protein bovin Bos taurus (Bovine) Bovine MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE A55C1B856B1C3515 mt_nd3-ndufa9 1 NDUFA9 2 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ND3 3 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association mint Then, we went on to identify the proteins that had been cleaved from the crosslinked product formed specifically in the D-form of the enzyme, by mass spectrometry. Spot 1 was positively identified as subunit ND3 (NU3M) and spot 2 as 39 kDa subunit (NDUFA9) (Table 1). The MS/MS spectrum of the peptide from the ND3 subunit, TSPYECGFDPMGSAR, is shown in Fig. 3 f2 t1 f3