IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-som_stem_cell Mouse somatic stem cell somatic_stem_cell Somatic (adult) stem cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. Interactions involving Histone H3 not included as there could not be mapped to a single gene product. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-som_stem_cell Mouse somatic stem cell somatic_stem_cell Somatic (adult) stem cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. Interactions involving Histone H3 could not be added as these could not be mapped to a single gene product. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. The sequence length given by the author for Kdm6b (Jmjd3) does not match anything in either UniProt, Ensembl or MGI - it has therefore not been possible to accurately map deletion or point mutation data. Interactions involving tagged Trim26 could not be included as the species of origin of this construct was not given. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-som_stem_cell Mouse somatic stem cell somatic_stem_cell Somatic (adult) stem cell ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation. Cell (0092-8674) 2013 imex curation Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. rwang3@tmhs.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Zhao W., Li Q., Ayers S., Gu Y., Shi Z., Zhu Q., Chen Y., Wang H.Y., Wang R.F. The sequence length given by the author for Kdm6b (Jmjd3) does not match anything in either UniProt, Ensembl or MGI - it has therefore not been possible to map deletion or point mutation data. rwang3@tmhs.org Accepted 2015-NOV-26 AT 13:46 GMT AT 13:46 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation 6F/G not added because origin of Trim26 not given (I think from the casing its mouse but can't prove it). there is a data processing comment.; See data processing comment. po5f1_mouse_gene POU domain, class 5, transcription factor 1 gene gene mouse Mus musculus Mouse kat8_mouse Histone acetyltransferase KAT8 Kat8 Mof MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1 Myst1 Lysine acetyltransferase 8 protein protein mouse Mus musculus Mouse MAAQGATAAVAATTSGTVGEGEPGPGENAAVEGPARSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK FA25E0C8D7E46CEC rbbp5_mouse Retinoblastoma-binding protein 5 Rbbp5 protein protein mouse Mus musculus Mouse MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVPSSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEGSTKGKVQAELSQSLAAGGAISELL DIP protein Q8BX09 original sequence version: 118 DIP protein Q8BX09 original sequence version: 114 7D4E9FD5B38A7EB0 kat8_human Histone acetyltransferase KAT8 KAT8 MOF PP7073 MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1 MYST1 Lysine acetyltransferase 8 protein protein human Homo sapiens Human MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK 66C474BE5B90E8E3 wdr5_mouse WD repeat-containing protein 5 Wdr5 Big Big3 BMP2-induced 3-kb gene protein WD repeat-containing protein BIG-3 protein protein mouse Mus musculus Mouse MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC DIP protein P61965 original sequence version: 124 DIP protein P61965 original sequence version: 118 4BF30914A2250286 phf20_human PHD finger protein 20 Transcription factor TZP Novel zinc finger protein PHF20 C20orf104 GLEA2 HCA58 NZF TZP Hepatocellular carcinoma-associated antigen 58 Glioma-expressed antigen 2 protein protein human Homo sapiens Human MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLEKIQLRKEGLHEEDGSSEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDSNSQTLQPITLELRRRKISKGCEVPLKRPRLDKNSSQEKSKNYSENTDKDLSRRRSSRLSTNGTHEILDPDLVVSDLVDTDPLQDTLSSTKESEEGQLKSALEAGQVSSALTCHSFGDGSGAAGLELNCPSMGENTMKTEPTSPLVELQEISTVEVTNTFKKTDDFGSSNAPAVDLDHKFRCKVVDCLKFFRKAKLLHYHMKYFHGMEKSLEPEESPGKRHVQTRGPSASDKPSQETLTRKRVSASSPTTKDKEKNKEKKFKEFVRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNPDEELDGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDPPGQRPGFKYWYDKEWLSRGHMHGLAFLEENYSHQNAKKIVATHQLLGDVQRVIEVLHGLQLKMSILQSREHPDLPLWCQPWKQHSGEGRSHFRNIPVTDTRSKEEAPSYRTLNGAVEKPRPLALPLPRSVEESYITSEHCYQKPRAYYPAVEQKLVVETRGSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVSKKALPEEAPARKLLDRGGEGLLSSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPPEPLARLPQLKHCIKQLLMDLGKVQQIALCCST 1CDBADC23D007503 phf20_mouse PHD finger protein 20 Phf20 Hca58 Hepatocellular carcinoma-associated antigen 58 homolog protein protein mouse Mus musculus Mouse MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGRVLIHFKRWNHRYDEWFCWDSPYLRPLEKIQLRKEGLHDEDGSSEFQINQQVLACWSDCRFYPARVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARPKETDHKSLSSSPEKREKFKEQRKVTVNVKKDKVEKALKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENEREYSGDAQVEKKPEKDLVKNPQENLKEPKRKRGRPPSITPTAVDSNSQTLQPITLELRRRKISKRSDTPLKRPRLDKNSPQEQSKKRSENSDKDLSRRRSSRLSTNGTREILDPDSIVPDLVHTVDTNPLPDKSPSAKDSAEGQLKSPLEAGQVSSALTCHPIGDGLGAADLELNCKSMGENTMKTEPVSPLAEVQEVSTVEVPNTLKKVDDSVTLNVPAVDLDHKFRCKVLDCLKFFRKAKLLHYHMKYFHGMEKSPEPEEGPGKTHVQTRGSAVPDKTSQESLTRKRVSASSPTAKEKEKTKEKKFKELVRVKPKKKKKKKKKTKPECPCSEDISDTSQEPSPPKTFAVTRCGSSHKPGVHMSPQLHGSDNGNHKGKLKTCEEDNLSESSSESFLWSDEEYGQDVDVTTNPDEELEGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDPPGQRPGFKYWYDKEWLSRGHMHGLAFLDQNYSHQNARKIVATHQLLGDVQRVIQVLHGLQLKMSILQSREHPDLQLWCQPWKQHSGEGRAHPRHIHITDARSEESPSYRTLNGAVEKPSPLPRSVEESYITSEHCYQKPRAYYPAVEQRLVVETRGSALDAAVSPLCENGDDSLSPRLGWPIDQDRSRGDIDPKPSSPKVREYISKNVLPEETPARKLLDRGGEGLVSSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPPEPLARLPQLKHCIKQLLTDLGKVQQIALCCST 2BC32811A520342D kdm6b_mouse Lysine-specific demethylase 6B JmjC domain-containing protein 3 Jumonji domain-containing protein 3 Kdm6b Kiaa0346 Jmjd3 [histone H3]-trimethyl-L-lysine(27) demethylase 6B protein protein mouse Mus musculus Mouse MHRAVDPPGARSAREAFALGGLSCAGAWSSCPPHPPPRSSWLPGGRCSASVGQPPLSAPLPPSHGSSSGHPNKPYYAPGTPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGAKRGGPPVKRSAEPPVVQPMPPAALSGPSGEEGLSPGGKRRRGCSSEQAGLPPGLPLPPPPPPPPPPPPPPPPPPPPLPGLAISPPFQLTKPGLWNTLHGDAWGPERKGSAPPERQEQRHSMPHSYPYPAPAYSAHPPSHRLVPNTPLGPGPRPPGAESHGCLPATRPPGSDLRESRVQRSRMDSSVSPAASTACVPYAPSRPPGLPGTSSSSSSSSSSNNTGLRGVEPSPGIPGADHYQNPALEISPHQARLGPSAHSSRKPFLTAPAATPHLSLPPGTPSSPPPPCPRLLRPPPPPAWMKGSACRAAREDGEILGELFFGAEGPPRPPPPPLPHRDGFLGPPNPRFSVGTQDSHNPPIPPTTTSSSSSSNSHSSSPTGPVPFPPPSYLARSIDPLPRPSSPTLSPQDPPLPPLTLALPPAPPSSCHQNTSGSFRRSESPRPRVSFPKTPEVGQGPPPGPVSKAPQPVPPGVGELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQQQEAGVAPPPPLKEPFASLQPPFPSDTAPATTTAAPTTATTTTTTTTTTTQEEEKKPPPALPPPPPLAKFPPPPQPQPPPPPPASPASLLKSLASVLEGQKYCYRGTGAAVSTRPGSVPATQYSPSPASGATAPPPTSVAPSAQGSPKPSVSSSSQFSTSGGPWAREHRAGEEPAPGPVTPAQLPPPLPLPPARSESEVLEEISRACETLVERVGRSAINPVDTADPVDSGTEPQPPPAQAKEESGGVAVAAAGPGSGKRRQKEHRRHRRACRDSVGRRPREGRAKAKAKAPKEKSRRVLGNLDLQSEEIQGREKARPDVGGVSKVKTPTAPAPPPAPAPAAQPTPPSAPVPGKKTREEAPGPPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAADVMRASKNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPVLLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLTGTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEERESEDEESEEPDSTTGTSPSSAPDPKNHHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILDDLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLEQYRTEELAQAYDAFTLAPASTSR DIP protein Q5NCY0 original sequence version: 27 6CBE3620998427EA h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 phf20-kdm6b-2 5 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 22 24 26 22 physical association physical association Fig. 5A, 5C, 5D, Supp. Fig. 5C, 5D phf20-kdm6b-1 7 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig. 5B kdm6b-phf20-1 9 17 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 5A phf20-kat8 1 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Fig. 7H wdr5-po5f1-1 2 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7I Interaction was not observed in PHF20-/- cells. rbbp5-po5f1-1 2 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait association association Fig. 7I Interaction was not observed in PHF20-/- cells. kat8-po5f1-1 2 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 7I Interaction was reduced in PHF20-/- cells. hist1h4h-po5f1-1 2 10 unspecified role unspecified role prey prey cr1-cr4 promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait lys-17 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain association association Fig. 7J rbbp5-po5f1_mouse_gene-1 4 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait association association Fig. 7C, Supp. Fig. 7C Interaction was not observed in PHF20-/- cells. phf20-po5f1_mouse_gene-1 3 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait association association Fig. 7C, Supp. Fig. 7C Interaction was not observed in PHF20-/- cells. phf20-po5f1_mouse_gene-2 6 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait association association Supp. Fig. 7E Interaction was not observed in PHF20-/- cells. wdr5-po5f1_mouse_gene-1 6 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 7E Interaction was not observed in PHF20-/- cells. phf20-po5f1_mouse_gene-3 8 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait association association Supp. Fig. 7E Interaction was not observed in PHF20-/- cells. wdr5-po5f1_mouse_gene-2 8 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 7E Interaction was not observed in PHF20-/- cells. wdr5-po5f1_mouse_gene-3 4 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7I Interaction was not observed in PHF20-/- cells. rbbp5-po5f1_mouse_gene-2 4 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7I Interaction was not observed in PHF20-/- cells. kat8-po5f1_mouse_gene-1 4 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 7I Interaction was not observed in PHF20-/- cells. hist1h4h-po5f1_mouse_gene-1 4 18 unspecified role unspecified role bait bait lys-17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7J Interaction was not observed in PHF20-/- cells.