IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human VRK2 modulates apoptosis by interaction with Bcl-xL and regulation of BAX gene expression. Human VRK2 modulates apoptosis by interaction with Bcl-xL and regulation of BAX gene expression. Cell death & disease 2013 imex curation Monsalve DM., Merced T., Fernández IF., Blanco S., Vázquez-Cedeira M., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis 2012-12-05: P Lazo, Instituto de Biología Molecular y Celular del Cáncer, Centro de Investigación del Cáncer (CIC), Consejo Superior de Investigaciones Científicas (CSIC), Universidad de Salamanca Data files for this submission can be found in ebi/sp/pro6/intact/local/data/curation-material/2012/lazo-2012 plazozbi@usal.es,pedro.lazo@csic.es 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment relates to a negative interaction. 2012-12-05: P Lazo, Instituto de Biología Molecular y Celular del Cáncer, Centro de Investigación del Cáncer (CIC), Consejo Superior de Investigaciones Científicas (CSIC), Universidad de Salamanca Data files for this submission can be found in ebi/sp/pro6/intact/local/data/curation-material/2012/lazo-2012 plazozbi@usal.es plazozbi@usal.es,pedro.lazo@csic.es Accepted 2013-MAR-06 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. 2013 Only protein-protein interactions imex curation q86y07-2 Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 VRK2B protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQVEA No experimental confirmation available 0308378DD02D85EC q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE vrk2-bcl2l1-1 1 VRK2B 2 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Bcl-xL 3 unspecified role unspecified role prey prey physical association physical association true 1d