MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions. Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions. FEBS J. (1742-464X) 2013 Pellegrini M., Willen L., Perroud M., Krushinskie D., Strauch K., Cuervo H., Day ES., Schneider P., Zheng TS. suggested by lperfetto in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Pellegrini M., Willen L., Perroud M., Krushinskie D., Strauch K., Cuervo H., Day ES., Schneider P., Zheng TS. suggested by lperfetto FEBS J. (1742-464X) 2013 Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions. Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions. FEBS J. (1742-464X) 2013 Pellegrini M., Willen L., Perroud M., Krushinskie D., Strauch K., Cuervo H., Day ES., Schneider P., Zheng TS. suggested by lperfetto in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Pellegrini M., Willen L., Perroud M., Krushinskie D., Strauch K., Cuervo H., Day ES., Schneider P., Zheng TS. suggested by lperfetto FEBS J. (1742-464X) 2013 tnr12_human Tumor necrosis factor receptor superfamily member 12A TNFRSF12A FN14 Fibroblast growth factor-inducible immediate-early response protein 14 Tweak-receptor protein protein human Homo sapiens Human MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ BF3FDFB9C1E1C448 tnf12_human Tumor necrosis factor ligand superfamily member 12 TNFSF12 APO3L DR3LG APO3 ligand TNF-related weak inducer of apoptosis UNQ181/PRO207 protein protein human Homo sapiens Human MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH E660843361C28EBA q6six7_xenla tnfrsf12a.L Fn14 tnfrsf12a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTPRNLLRTFVPLLLLVLSSAASQGECPEGRAYSQDLGKCMECSVCKNSEKSDFCQNCPSKTEQPDFPWIWVIGFSAGGVFLIIVILSLTVYLTHCRRKSKFTTPIEETGSHSAEALLIH mint F5B5D0BBAA3F7B4F tnfsf12-tnfrsf12a 1 hFn14 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Stoichiometry: 1.3 TWEAK 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 3.1 direct interaction direct interaction f2c homomint mint hFn14 binds to hTWEAK with a KD = 65 nM (Fig. 2C) while xeFn14 binds to hTWEAK with a KD = 1.3 MM (Fig. 2D) tnfsf12-tnfrsf12a-1 1 xeFn14 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Stoichiometry: 1.3 TWEAK 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 3.1 direct interaction direct interaction f2d mint hFn14 binds to hTWEAK with a KD = 65 nM (Fig. 2C) while xeFn14 binds to hTWEAK with a KD = 1.3 MM (Fig. 2D) tnfrsf12a-tnfsf12 2 xeFn14 5 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait purified purified TWEAK 4 antibody detection identification by antibody antibody detection antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2b mint tnfrsf12a-tnfsf12-1 2 TWEAK 4 antibody detection identification by antibody antibody detection antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hFn14 3 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait purified purified direct interaction direct interaction f2b homomint mint