MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. EMBO J. (0261-4189) 2013 imex curation Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es Accepted 2014-MAY-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. EMBO J. (0261-4189) 2013 imex curation Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es Accepted 2014-MAY-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3. EMBO J. (0261-4189) 2013 imex curation Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Boada-Romero E., Letek M., Fleischer A., Pallauf K., Ramón-Barros C., Pimentel-Muiños F.X. fxp@usal.es Accepted 2014-MAY-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation ap1m1_human AP-1 complex subunit mu-1 Golgi adaptor HA1/AP1 adaptin mu-1 subunit Mu-adaptin 1 AP-mu chain family member mu1A Mu1A-adaptin Clathrin coat assembly protein AP47 Clathrin coat-associated protein AP47 Adaptor protein complex AP-1 subunit mu-1 Clathrin assembly protein complex 1 mu-1 medium chain 1 AP1M1 CLTNM Adaptor-related protein complex 1 subunit mu-1 protein protein human Homo sapiens Human MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ 64EC5E47EA6F8E98 tlr2_human Toll-like receptor 2 Toll/interleukin-1 receptor-like protein 4 TLR2 TIL4 protein protein human Homo sapiens Human MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS DIP protein O60603 original sequence version: 92 DIP protein O60603 original sequence version: 114 7DBE6B24CF1FAF8B nod2_human Nucleotide-binding oligomerization domain-containing protein 2 IBD1 NOD2 CARD15 Caspase recruitment domain-containing protein 15 Inflammatory bowel disease protein 1 protein protein human Homo sapiens Human MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL DIP protein Q9HC29 original sequence version: 141 DIP protein Q9HC29 original sequence version: 77 DIP protein Q9HC29-1 original sequence version: 100 DIP protein Q9HC29-1 original sequence version: 106 mint homomint Induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS) Defects in NOD2 are the cause of Blau syndrome (BS) [MIM:186580]. BS is a rare autosomal dominant disorder characterized by early-onset granulomatous arthritis, uveitis and skin rash Defects in NOD2 are a cause of susceptibility to Crohn disease (CD) [MIM:266600]. CD is a form of remitting inflammatory bowel disease (IBD). CD may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous. Crohn disease is commonly classified as autoimmune disease Defects in NOD2 are a cause of susceptibility to ulcerative colitis [MIM:191390]. It is a chronic inflammatory bowel disease. In ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers. Ulcerative colitis is commonly classified as autoimmune disease Defects in NOD2 are the cause of early-onset sarcoidosis (EOS) [MIM:609464]. Sarcoidosis is a multiorganic inflammatory disease with unknown etiology, characterized by the histologic features of non-caseating epithelioid granulomas. In childhood, 2 distinct types of sarcoidosis have been described. Usually the disease is detected in older children by chest radiography and the clinical manifestations are characterized by a classical triad of lung, lymph node, and eye involvement, similar to those in adults. In contrast, early-onset sarcoidosis (EOS), which usually appears in those younger than 4 years of age, is quite rare and has a distinct triad of skin, joint, and eye disorders, without apparent pulmonary involvement. Compared with an asymptomatic and sometimes naturally disappearing course of the disease in older children, EOS is progressive and in many cases causes severe complications, such as blindness, joint destruction, and visceral involvement 0037592D96D7DDFF tmm59_human Transmembrane protein 59 TMEM59 C1orf8 Liver membrane-bound protein HSPC001 UNQ169/PRO195 protein protein human Homo sapiens Human MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI mint 0926AB7D12D1B902 ap2m1_human AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain AP2M1 CLAPM1 KIAA0109 Adaptin-mu2 Plasma membrane adaptor AP-2 50 kDa protein HA2 50 kDa subunit Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein human Homo sapiens Human MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 82803219BA279954 dedd2_human DNA-binding death effector domain-containing protein 2 DEDD2 FLAME3 DED-containing protein FLAME-3 FADD-like anti-apoptotic molecule 3 PSEC0004 protein protein human Homo sapiens Human MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLARARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTSSSSKRTEGSCRRRRQSSSSANSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSVDEADYEAGRRRLLLMEEEGGRRPTEAS 3F7B0B307CC870CD t3jam_human TRAF3-interacting JNK-activating modulator TRAF3-interacting protein 3 TRAF3IP3 T3JAM protein protein human Homo sapiens Human MISPDPRPSPGLARWAESYEAKCERRQEIRESRRCRPNVTTCRQVGKTLRIQQREQLQRARLQQFFRRRNLELEEKGKAQHPQAREQGPSRRPGQVTVLKEPLSCARRISSPREQVTGTSSEVFPAQHPPPSGICRDLSDHLSSQAGGLPPQDTPIKKPPKHHRGTQTKAEGPTIKNDASQQTNYGVAVLDKEIIQLSDYLKEALQRELVLKQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKLQGADSRDLQMNQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLLQNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAKEKECRELHSELDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPVLMVVIAAALAVFLANKDNLMI EA2DFF45A8D6ED19 mlp3a_human Microtubule-associated proteins 1A/1B light chain 3A Microtubule-associated protein 1 light chain 3 alpha MAP1A/MAP1B light chain 3 A MAP1 light chain 3-like protein 1 Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1LC3A protein protein human Homo sapiens Human MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF 48C1FBE8F7892AF3 a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY DIP protein Q676U5 original sequence version: 96 5A5816AE2CF03CA0 tmem59-atg16l1 3 TMEM59 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range sufficient to bind sufficient binding region sufficient to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 11:06:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,tyr277ala,glu272ala,leu280ala' Wed May 02 18:57:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 20:12:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b f6d atg16l1-tmem59 3 TMEM59 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range required to bind necessary binding region required to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:24:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 17:46:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6c sf16b atg16l1-tmem59-1 1 TMEM59 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified range sufficient to bind sufficient binding region sufficient to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain Y A Fri Jul 22 11:15:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu272ala,tyr277ala,leu280ala,tyr268ala' Wed May 02 19:27:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 17:04:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f6e tmem59-atg16l1-1 3 TMEM59 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 10:50:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu272ala,tyr268ala,tyr277ala,leu280ala' Wed May 02 19:39:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 16:08:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' Coimmunoprecipitation studies showed that the WD domain is both necessary (Figure 7A and B) and sufficient (Figure 7C and D) for interaction with TMEM59 through the ATG16L1-binding motif (Figure 7E and F). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7a f7c f7e atg16l1-tmem59-2 3 TMEM59 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain E A Fri Jul 22 10:54:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,tyr277ala,leu280ala,glu272ala' Wed May 02 19:34:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 18:51:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' Coimmunoprecipitation studies showed that the WD domain is both necessary (Figure 7A and B) and sufficient (Figure 7C and D) for interaction with TMEM59 through the ATG16L1-binding motif (Figure 7E and F). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell range required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7b f7d f7f atg16l1-tmem59-3 3 NOD2 6 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range sufficient to bind sufficient binding region sufficient to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9HC29:p.[Trp63Ala;Glu64Ala;Trp68Ala;Glu69Ala;Asp70Ala;Tyr71Ala;Glu72Ala;Phe74Ala;Leu77Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain W A Fri Jul 22 11:15:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu77ala,phe74ala,glu72ala,tyr71ala,asp70ala,glu69ala,trp68ala,glu64ala,trp63ala' Wed May 02 15:48:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp63ala,glu64ala,trp68ala,glu69ala,asp70ala,tyr71ala,glu72ala,phe74ala,leu77ala' Tue Jun 30 19:26:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp63Ala;Glu64Ala;Trp68Ala;Glu69Ala;Asp70Ala;Tyr71Ala;Glu72Ala;Phe74Ala;Leu77Ala]' 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f8c F8E sf15a atg16l1-nod2 3 TLR2 5 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell range required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f8d f8e sf15b tmem59-ap1m1 3 TMEM59 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 10:54:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu272ala,tyr268ala,tyr277ala,leu280ala' Wed May 02 14:26:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 16:47:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' Coimmunoprecipitation studies showed that the WD domain is both necessary (Figure 7A and B) and sufficient (Figure 7C and D) for interaction with TMEM59 through the ATG16L1-binding motif (Figure 7E and F). AP1M1 4 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association sf14a tmem59-ap1m1-1 3 TMEM59 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 10:49:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu272ala,tyr277ala,tyr268ala,leu280ala' Wed May 02 19:20:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 15:37:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' Coimmunoprecipitation studies showed that the WD domain is both necessary (Figure 7A and B) and sufficient (Figure 7C and D) for interaction with TMEM59 through the ATG16L1-binding motif (Figure 7E and F). AP2M1 8 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association sf14b tmem59-atg16l1-2 1 TMEM59 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range sufficient to bind sufficient binding region sufficient to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Q9BXS4:p.[Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:56:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala,leu280ala' Tue Jun 30 15:58:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr277Ala;Leu280Ala]' This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf14d tmem59-atg16l1-3 2 TMEM59 7 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Q9BXS4:p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:54:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala,glu272ala,tyr277ala,leu280ala' Tue Jun 30 16:04:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr268Ala;Glu272Ala;Tyr277Ala;Leu280Ala]' This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). LC3A 11 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization sf10c atg16l1-tlr2 3 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined T3JAM 10 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). physical association physical association f8g f8h atg16l1-traf3ip3 3 DEDD2 9 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This interaction was decreased in the case of the 4M derivatives (Figure 6B and C), arguing that it is mediated by the identified motif. Interestingly, the 263–281 peptide fused to GST sufficed to precipitate ATG16L1 and, again, the mutated version was inactive (Figure 6D). 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f8g f8h