IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell (0092-8674) 2013 imex curation Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. Bax was incubated with increasing concentrations of peptides, samples were injected onto a CM7 chip bearing immobilized BimBH3. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2013-SEP-10 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell (0092-8674) 2013 imex curation Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2013-SEP-10 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell (0092-8674) 2013 imex curation Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2013-SEP-10 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell (0092-8674) 2013 imex curation Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. A BAX-GFP fusion protein also crystallised (4BDU) but has not been entered as this fusion is no biological existence. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2013-SEP-10 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell (0092-8674) 2013 imex curation Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. czabotar@wehi.edu.au, pcolman@wehi.edu.au 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Czabotar P.E., Westphal D., Dewson G., Ma S., Hockings C., Fairlie W.D., Lee E.F., Yao S., Robin A.Y., Smith B.J., Huang D.C., Kluck R.M., Adams J.M., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Crystal 4BDU and data in S6F is effected by the GFP tag which itself dimerizes so have treated it as a biologically irrelevant fusion protein and not a tag, and not curated the data. Cross-linking agent is Bismaleimidoethane (BMOE) - a short-arm, maleimide crosslinker for sulfhydryl conjugation. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2013-SEP-10 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT 291A142B27167E70 bax-1 2 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, 1C, 3B Octylmaltoside nonionic detergent BIM BH3 peptide + CHAPS - mutations leu152ala and pro144_glu145ala inhibit this. BID BH3 peptide + CHAPS - mutations ile182-183ala inhibit this. BK BH3 peptide + CHAPS BAX BH3 peptide + CHAPS NOXA and BAD BH3 peptides + CHAPS did not induce dimer formation bax-1 3 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q07812:p.[Val121Cys;Ile136Cys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V C certain certain sequence position certain certain certain sequence position certain I C Wed May 02 15:07:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val121cys,ile136cys' Tue Jun 30 20:21:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val121Cys;Ile136Cys]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Octylmaltoside nonionic detergent BIM BH3 peptide + CHAPS BID BH3 peptide + CHAPS BAX BH3 peptide + CHAPS BAK BH3 peptide + CHAPS Mutation of the BimBH3 phe159ala and met97ala, respectively) reduces their ability to promote dimerization of Bax wild-type and particularly of Bax ile66ala. DTT Fig. 1A, 5H, Supp Table 1, Supp Fig. 4D bax-bid-4 4 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 20 direct interaction direct interaction Rworking = 0.18 Rfree = 0.23 2.2A Fig. 1A, 5H, Supp Table 1, Supp Fig. 4D bax-bax-5 4 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 27 25 direct interaction direct interaction Supp Table 1 Rworking = 0.25 Rfree = 0.29 2.2A bax-bax-6 4 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 32 direct interaction direct interaction Supp Table 1 Rworking = 0.2 Rfree = 0.27 (4BD7), Rworking = 0.2 Rfree = 0.26 (4BD8) 2.2A (4BD7/4BD8) bax-bax-7 3 6 unspecified role unspecified role neutral component neutral component Q07812:p.Arg109Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R D Wed May 02 15:17:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109asp' Tue Jun 30 17:08:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg109Asp' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q07812:p.Asp68Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R Wed May 02 16:40:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp68arg' Tue Jun 30 17:13:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp68Arg' chemical synthesis Chemical synthesis (Chemical synthesis) 36 38 direct interaction direct interaction Fig. 3E bcl2l11-bax-8 1 7 unspecified role unspecified role bait bait bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 44 46 physical association physical association Supp. Fig. 3A, 3B bcl2l11-bax-9 1 7 unspecified role unspecified role bait bait bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 51 53 physical association physical association Supp. Fig. 3A, 3C Mutation Cys25Ile of the BCL2L11 protein stimulated the blocking of binding of Bax to BIM by this protein. bcl2l11-bax-7 1 7 unspecified role unspecified role bait bait bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 60 58 physical association physical association Fig. 5G Supp. Fig. 3A, 3B, 3D Mutations Leu152Ala of the BIM protein inhibit the blocking of binding of Bax to immobilised BIM by this protein. bcl2l11-bax-10 1 7 unspecified role unspecified role bait bait bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P55957:p.Ile82_Ile83delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain II AA Thu Jul 07 12:06:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ile82_83ala Fri Jul 22 11:02:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile82ala,ile83ala' Wed May 02 16:01:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_ile82-83ala_ala' Tue Jun 30 16:20:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile82_Ile83delinsAlaAla' P55957:p.Met97Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 15:22:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met97ala' Tue Jun 30 20:19:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met97Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 65 69 physical association physical association Supp. Fig. 3A, 3B Mutations Ile82_83Ala and also Met97Ala of the Bid protein inhibit the blocking of binding of Bax to BIM by this protein. bcl2l11-bak1 1 7 unspecified role unspecified role bait bait bh3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 74 76 physical association physical association Supp. Fig. 3A, 3B bax-1 5 6 unspecified role unspecified role neutral component neutral component Q07812:p.Glu69Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E C Wed May 02 17:14:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu69cys' Tue Jun 30 17:52:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu69Cys' Q07812:p.Ser184Leu mutation mutation certain certain sequence position certain certain certain sequence position certain S L Wed May 02 15:08:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser184leu' Tue Jun 30 16:10:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser184Leu' physical association physical association Fig. 6C BID BH3 peptide + CHAPS Full-length Bax glu69cys residues exposed to an apoptotic stimulus (tBid) could be crosslinked with the 8A linker BMOE, whereas residues farther apart (arg65cys) could not