IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-macrophage Mus musculus macrophage macrophage Macrophage ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Induction of Siglec-G by RNA viruses inhibits the innate immune response by promoting RIG-I degradation. Cell (0092-8674) 2013 imex curation Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Chen W., Han C., Xie B., Hu X., Yu Q., Shi L., Wang Q., Li D., Wang J., Zheng P., Liu Y., Cao X. I have not captured all the cases where ubiquitin was transfected into a whole cell, then a protein IP'd and western blotted with anti-Ub - I have treated that as evidence of a PTM not an interaction. Proteins with the same tag were differentiated by molecular weight. caoxt@immunol.org Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation sig10_mouse Sialic acid-binding Ig-like lectin 10 Siglec10 Sialic acid-binding Ig-like lectin G Siglecg protein protein mouse Mus musculus Mouse MSLLLFLLSFLLDGPQGQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSKGAVLGFGITALLALCLIVVIVKTLQKKGTQEEPSRPKLSRGSTILDYINVVPKTRSLARNWKAEPDAPSRSSPLDTHFPKPKKKQKDPHFTYPGCPDPTSSSQVPVSENNPEELHYAALNFSRLRLQETQDPQDTYSDYTEVRVH 21A619E1500BFA76 ddx58_mouse Antiviral innate immune response receptor RIG-I Ddx58 DEAD box protein 58 RIG-I-like receptor 1 Retinoic acid-inducible gene 1 protein Retinoic acid-inducible gene I protein Probable ATP-dependent RNA helicase DDX58 protein protein mouse Mus musculus Mouse MTAEQRQNLQAFRDYIKKILDPTYILSYMSSWLEDEEVQYIQAEKNNKGPMEAASLFLQYLLKLQSEGWFQAFLDALYHAGYCGLCEAIESWDFQKIEKLEEHRLLLRRLEPEFKATVDPNDILSELSECLINQECEEIRQIRDTKGRMAGAEKMAECLIRSDKENWPKVLQLALEKDNSKFSELWIVDKGFKRAESKADEDDGAEASSIQIFIQEEPECQNLSQNPGPPSEASSNNLHSPLKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERLGYNIASISGATSDSVSVQHIIEDNDIIILTPQILVNNLNNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASVGVGDAKTAEEAMQHICKLCAALDASVIATVRDNVAELEQVVYKPQKISRKVASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREFGTQKYEQWIVGVHKACSVFQMADKEEESRVCKALFLYTSHLRKYNDALIISEDAQMTDALNYLKAFFHDVREAAFDETERELTRRFEEKLEELEKVSRDPSNENPKLRDLYLVLQEEYHLKPETKTILFVKTRALVDALKKWIEENPALSFLKPGILTGRGRTNRATGMTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSKCFLLTSSADVIEKEKANMIKEKIMNESILRLQTWDEMKFGKTVHRIQVNEKLLRDSQHKPQPVPDKENKKLLCGKCKNFACYTADIRVVETSHYTVLGDAFKERFVCKPHPKPKIYDNFEKKAKIFCAKQNCSHDWGIFVRYKTFEIPVIKIESFVVEDIVSGVQNRHSKWKDFHFERIQFDPAEMSV 119FC0F88BC56957 kmt2a_mouse Histone-lysine N-methyltransferase 2A Kmt2a ALL-1 All1 Hrx Mll Mll1 Myeloid/lymphoid or mixed-lineage leukemia Myeloid/lymphoid or mixed-lineage leukemia protein 1 Zinc finger protein HRX Cysteine methyltransferase KMT2A protein protein mouse Mus musculus Mouse MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPQAGGGGPGAPPSPPAVAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKASPRKPRGRPRSGSDRNPAILSDPSVFSPLNKSETKSADKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDIAELTQGSKEDSLKKVKRTPSAMFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSCKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPMKIARLESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSIDTTSDSQASEEIQALPEERSNTPEVHTPLPISQSPENESNDRRSRRYSMSERSFGSRATKKLPTLQSAPQQQTSSSPPPPLLTPPPPLQPASGISDHTPWLMPPTIPLASPFLPASAAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDIHKRSPILRAPRFTPSEAHSRIFESVTLPSNRTSSGASSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSIPVSPLAASALNPTFTFPSHSLTQSGESTEKNQRARKQTSALAEPFSSNSPALFPWFTPGSQTEKGRKKDTAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSDIQSSSALYPVGRVSKEKVAGEDVGTSSSAKKATGRKKSSSLDSGADVAPVTLGDTTAVKAKILIKKGRGNLEKNNLDLGPAAPSLEKERTPCLSAPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSVAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGICTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKASLQKQTKAVKKKEKKSKTTEKKESKESTAVKSPLEPAQKAAPPPREEPAPKKSSSEPPPRKPVEEKSEEGGAPAPAPAPEPKQVSAPASRKSSKQVSQPAAVVPPQPPSTAPQKKEAPKAVPSEPKKKQPPPPEPGPEQSKQKKVAPRPSIPVKQKPKDKEKPPPVSKQENAGTLNILNPLSNGISSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQASLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDEQQPLDLEGVKKRMDQGSYVSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSNNSGMLPNAVLPPSLDHNYAQWQEREESSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVVEPDINSTVEHDDNRTIAHSPSSFIDASCKDSQSTAAILSPPSPDRPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPLRSKLRIMSPVRTGSAYSRSSVSSVPSLGTATDPEASAKASDRGGLLSSSANLGHSAPPSSSSQRTVGGSKTSHLDGSSPSEVKRCSASDLVPKGSLVKGEKNRTSSSKSTDGSAHSTAYPGIPKLTPQVHNATPGELNISKIGSFAEPSTVPFSSKDTVSYPQLHLRGQRSDRDQHMDPSQSVKPSPNEDGEIKTLKLPGMGHRPSILHEHIGSSSRDRRQKGKKSSKETCKEKHSSKSYLEPGQVTTGEEGNLKPEFADEVLTPGFLGQRPCNNVSSEKIGDKVLPLSGVPKGQSTQVEGSSKELQAPRKCSVKVTPLKMEGENQSKNTQKESGPGSPAHIESVCPAEPVSASRSPGAGPGVQPSPNNTLSQDPQSNNYQNLPEQDRNLMIPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSNSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATSRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVIKSAVGHKNEPKLDNCHSVSRVKAQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNAELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNREKDIGLFEVFSQQLPATEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSEGDPALLSPGVDPAPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNSQDLTRNSGTPGLQVPVSPTVPVQNQKYVPSSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSPVSSTPSVMETNTSVLGPMGSGLTLTTGLNPSLPPSPSLFPPASKGLLSVPHHQHLHSFPAAAQSSFPPNISSPPSGLLIGVQPPPDPQLLGSEANQRTDLTTTVATPSSGLKKRPISRLHTRKNKKLAPSSAPSNIAPSDVVSNMTLINFTPSQLSNHPSLLDLGSLNPSSHRTVPNIIKRSKSGIMYFEQAPLLPPQSVGGTAATAAGSSTISQDTSHLTSGPVSALASGSSVLNVVSMQTTAAPTSSTSVPGHVTLANQRLLGTPDIGSISHLLIKASHQSLGIQDQPVALPPSSGMFPQLGTSQTPSAAAMTAASSICVLPSSQTAGMTAASPPGEAEEHYKLQRGNQLLAGKTGTLTSQRDRDPDSAPGTQPSNFTQTAEAPNGVRLEQNKTLPSAKPASSASPGSSPSSGQQSGSSSVPGPTKPKPKAKRIQLPLDKGSGKKHKVSHLRTSSEAHIPHRDTDPAPQPSVTRTPRANREQQDAAGVEQPSQKECGQPAGPVAALPEVQATQNPANEQENAEPKAMEEEESGFSSPLMLWLQQEQKRKESITERKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLAGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRQSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN DIP protein P55200 original sequence version: 99 DIP protein P55200 original sequence version: 140 EA9CB2A467AB3545 cbl_mouse E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene Cbl RING-type E3 ubiquitin transferase CBL protein protein mouse Mus musculus Mouse MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPSSPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDLPPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVATPNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHPKIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEATQSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSERKASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT DIP protein P22682 original sequence version: 166 22F8A5C29F0262B8 siglecg_mouse_gene Siglec-g gene gene gene mouse Mus musculus Mouse ro52_mouse E3 ubiquitin-protein ligase TRIM21 Trim21 Ro52 Ssa1 52 kDa Ro protein 52 kDa ribonucleoprotein autoantigen Ro/SS-A Ro(SS-A) Sjoegren syndrome type A antigen Tripartite motif-containing protein 21 RING-type E3 ubiquitin transferase TRIM21 protein protein mouse Mus musculus Mouse MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM 393AE5AFD254855B rnf14_mouse E3 ubiquitin-protein ligase RNF14 Rnf14 Ara54 Triad2 Androgen receptor-associated protein 54 Protein Triad2 RING finger protein 14 protein protein mouse Mus musculus Mouse MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD 6228A9827F16FA47 ptn11_mouse Tyrosine-protein phosphatase non-receptor type 11 Ptpn11 Protein-tyrosine phosphatase SYP SH-PTP2 protein protein mouse Mus musculus Mouse MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR DIP protein P35235 original sequence version: 93 DIP protein P35235 original sequence version: 99 DIP protein P35235 original sequence version: 138 6C71EEEECCF7F159 siglecg-cbl 1 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S5A siglecg-cbl-2 5 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6A ddx58-cbl 5 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6A cbl-ddx58 4 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 6B siglecg-cbl-3 6 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 6B cbl-ddx58-1 3 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association Fig. 6C Interaction detected in VSV-infected peritoneal macrophages from Siglecg+/+ mice but almost undetected from Siglecg–/– mice. cbl-ddx58-2 7 9 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6D Sendai viral infection ddx58-siglecg 7 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6D Sendai viral infection ddx58-cbl-1 5 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q80ZE3:p.[Tyr590Phe;Tyr635Phe;Tyr659Phe;Tyr679Phe] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:41:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr590phe,tyr635phe,tyr659phe,tyr679phe' Tue Jun 30 17:18:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr590Phe;Tyr635Phe;Tyr659Phe;Tyr679Phe]' cytoplasmic region required to bind necessary binding region required to bind range range certain certain sequence position certain 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E ddx58-siglecg-1 5 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined heli region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6F, ddx58-cbl-2 5 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 6B ddx58-ptpn11 5 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 6A SHP2 promotes Siglec-G interaction with RIG-I mll-siglecg 2 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Fig. 1H Vesicular stomatitis virus infection, but not lipopolysaccharide stimulation, increased MLL enrichment at Siglecg promoter in macrophages