MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it β-Arrestin-1 directly interacts with Gαs and regulates its function. β-Arrestin-1 directly interacts with Gαs and regulates its function. FEBS Lett. (0014-5793) 2013 Li B., Wang C., Zhou Z., Zhao J., Pei G. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Li B., Wang C., Zhou Z., Zhao J., Pei G. FEBS Lett. (0014-5793) 2013 β-Arrestin-1 directly interacts with Gαs and regulates its function. β-Arrestin-1 directly interacts with Gαs and regulates its function. FEBS Lett. (0014-5793) 2013 Li B., Wang C., Zhou Z., Zhao J., Pei G. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li B., Wang C., Zhou Z., Zhao J., Pei G. FEBS Lett. (0014-5793) 2013 β-Arrestin-1 directly interacts with Gαs and regulates its function. β-Arrestin-1 directly interacts with Gαs and regulates its function. FEBS Lett. (0014-5793) 2013 Li B., Wang C., Zhou Z., Zhao J., Pei G. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li B., Wang C., Zhou Z., Zhao J., Pei G. FEBS Lett. (0014-5793) 2013 β-Arrestin-1 directly interacts with Gαs and regulates its function. β-Arrestin-1 directly interacts with Gαs and regulates its function. FEBS Lett. (0014-5793) 2013 Li B., Wang C., Zhou Z., Zhao J., Pei G. in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Li B., Wang C., Zhou Z., Zhao J., Pei G. FEBS Lett. (0014-5793) 2013 gnaq_human Guanine nucleotide-binding protein G(q) subunit alpha GNAQ GAQ Guanine nucleotide-binding protein alpha-q protein protein human Homo sapiens Human MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P50148 original sequence version: 154 6F69C4F617DFA7C7 gnas1_human Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas GNAS GNAS1 Adenylate cyclase-stimulating G alpha protein Extra large alphas protein protein protein human Homo sapiens Human MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQVPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAEMEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADPPTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 02CB52383015E75D arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR DIP protein P49407 original sequence version: 138 DIP protein P49407 original sequence version: 69 DIP protein P49407 original sequence version: 92 DIP protein P49407 original sequence version: 103 0A3C135092338D10 gnas-arrb1 3 Gαs 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Beta-arrestin-1 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49407:p.Leu33Lys mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K Tue Jul 12 10:51:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:15:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu33lys' Tue Jun 30 16:12:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu33Lys' physical association physical association homomint mint f1a f1b f3a f3b gnaq-arrb1 3 Gαq 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Beta-arrestin-1 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a homomint mint gnaq-arrb1-1 1 Beta-arrestin-1 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gαq 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b homomint mint gnas-arrb1-1 1 Beta-arrestin-1 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P49407:p.Leu33Lys mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K Tue Jul 12 10:06:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:57:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu33lys' Tue Jun 30 15:41:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu33Lys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gαs 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f1b f3b arrb1-gnas 2 Gαs 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Beta-arrestin-1 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint gnas-arrb1-2 4 Gαs 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Beta-arrestin-1 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified direct interaction direct interaction homomint mint We used biolayer interferometry to conduct a kinetic analysis of the interaction between β-arrestin-1 and Gαs (Supplementary Fig. S1). Purified 50 μg/mL Gαs was biotinylated and immobilized on streptavidin pins (ForteBio Inc). The pins were washed and incubated in wells containing different concentrations of purified β-arrestin-1 (0.25 to 4 μM). The association/dissociation rate constants and the equilibrium dissociation constants of the interaction were obtained from the association and dissociation phases of the curves in the absence (Fig. 2A) or presence of either GDP (Fig. 2B) or GTPγS (Fig. 2C). All of the binding curves demonstrated very short and fast initial association/dissociation steps followed by association/dissociation steps that were slower and considerably longer f2 sf2 sf3 t1 gnas-arrb1-3 4 Gαs 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Beta-arrestin-1 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified P49407:p.Leu33Lys mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K Tue Jul 12 10:08:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:02:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu33lys' Tue Jun 30 18:50:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu33Lys' direct interaction direct interaction homomint mint We used biolayer interferometry to conduct a kinetic analysis of the interaction between β-arrestin-1 and Gαs (Supplementary Fig. S1). Purified 50 μg/mL Gαs was biotinylated and immobilized on streptavidin pins (ForteBio Inc). The pins were washed and incubated in wells containing different concentrations of purified β-arrestin-1 (0.25 to 4 μM). The association/dissociation rate constants and the equilibrium dissociation constants of the interaction were obtained from the association and dissociation phases of the curves in the absence (Fig. 2A) or presence of either GDP (Fig. 2B) or GTPγS (Fig. 2C). All of the binding curves demonstrated very short and fast initial association/dissociation steps followed by association/dissociation steps that were slower and considerably longer f2 sf2 sf3 t1 sf4 f3c f3d