IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Inactivation of BAD by IKK inhibits TNFα-induced apoptosis independently of NF-κB activation. Inactivation of BAD by IKK inhibits TNFα-induced apoptosis independently of NF-κB activation. Cell (0092-8674) 2013 imex curation Yan J., Xiang J., Lin Y., Ma J., Zhang J., Zhang H., Sun J., Danial N.N., Liu J., Lin A. Apoptosis - Interactions involving proteins with a function related to apoptosis Detail on constructs requested from author - no response. Interactions involving 14-3-3 proteins could not be curated as pan-14-3-3 antibodies were used. Interactions involving Ikbkb and IκBalpha also could not be curated as the origin of the constructs could not be traced. anninglin@bsd.uchicago.edu 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yan J., Xiang J., Lin Y., Ma J., Zhang J., Zhang H., Sun J., Danial N.N., Liu J., Lin A. Apoptosis - Interactions involving proteins with a function related to apoptosis Detail on constructs requested from author - no response. Interactions involving 14-3-3 proteins could not be curated as pan-14-3-3 antibodies were used. Interactions involving Ikbkb and IκBalpha also could not be curated as the origin of the constructs could not be traced. anninglin@bsd.uchicago.edu Accepted 2013-AUG-01 by MGT 09-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK 24D2AC79887E072E bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ DIP protein Q61337 original sequence version: 60 6C2BA910205053F7 bcl2l1-bad-1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig 5C, 5E Only nonphosphorylated, but not Ser26-phosphorylated, BAD was found to associate with BCL-XL TNF-alpha Interaction observed in Ikbkb -/- cells. bad-bcl2l1-3 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 4B Only nonphosphorylated, but not Ser26-phosphorylated, BAD was found to associate with BCL-XL. 14-3-3 proteins were also present in this interaction. Interaction observed in Ikbkb -/- cells. TNF-alpha