MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ubiquitin-like protein MNSFβ covalently binds to Bcl-G and enhances lipopolysaccharide/interferon γ-induced apoptosis in macrophages. Ubiquitin-like protein MNSFβ covalently binds to Bcl-G and enhances lipopolysaccharide/interferon γ-induced apoptosis in macrophages. FEBS J. (1742-464X) 2013 Watanabe J., Nakagawa M., Watanabe N., Nakamura M. suggested by lperfetto mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Watanabe J., Nakagawa M., Watanabe N., Nakamura M. suggested by lperfetto FEBS J. (1742-464X) 2013 b2l14_mouse Apoptosis facilitator Bcl-2-like protein 14 Bcl2l14 protein protein mouse Mus musculus Mouse MCSTSVYDLEDIPLEDDDPNSIEFKILAFYARHHVFKNTPAVFSPKLSRTRSLSQKALGTWSTDSWTQVSLPCRGSPSSEKNISLGKKKSSWRTLFRVAEKEEGLPSSPKEIRAQGPQGPFPVERQSGFHNQHWPRSLSSVEQRLESEVVDSKVACIANRVAEIVYSWPPPDVIHSQGGSKLKERVSEILYFRFEGPCDSKNKDGEDQIISKIVELLKFSGDQLGREIKKDKALMSSFQDGLSYSTFKTITDLFLRDVDTRGESEVKARGFKAALAIDAIAKLTAIDNHPMNRMLGFGTKYLREYFSPWVQQNGGWEKILGISHEEVD mint May play a role in apoptosis FAC47379F008314C ubim_mouse Ubiquitin-like protein FUBI Fau Monoclonal non-specific suppressor factor beta protein protein mouse Mus musculus Mouse MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG 315D314C260BEB87 bcl2l14-fau 1 Bcl-G 2 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MNSFβ 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c mint bcl2l14-fau-1 1 Bcl-G 2 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MNSFβ 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f1c mint bcl2l14-fau-2 1 Bcl-G 2 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell MNSFβ 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f1c mint bcl2l14-fau-3 1 Bcl-G 2 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell MNSFβ 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c mint