IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Cell (0092-8674) 2012 imex curation Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. kaestner@mail.med.upenn.edu 19-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. The only region on the gene described is 'nucleosome depleted' and as I don't think that corresponds to a region on a gene I've not added it as a binding feature. Partially differentiated EHP cells. RE-ChIp:Two rounds of ChIP performed, using two sequential anti-bait Abs. the second bait is described, with the first round bait being taken as a prey molecule. kaestner@mail.med.upenn.edu Accepted 2013-JUN-14 by MGT 19-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Cell (0092-8674) 2012 imex curation Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. kaestner@mail.med.upenn.edu 19-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. kaestner@mail.med.upenn.edu Accepted 2013-JUN-14 by MGT 19-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. Cell (0092-8674) 2012 imex curation Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. kaestner@mail.med.upenn.edu 19-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. The only region on the gene described is 'nucleosome depleted' and as I don't think that corresponds to a region on a gene I've not added it as a binding feature. Partially differentiated EHP cells. kaestner@mail.med.upenn.edu Accepted 2013-JUN-14 by MGT 19-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation hnf4a_mouse_gene Hepatocyte nuclear factor 4-alpha gene gene gene mouse Mus musculus Mouse albu_mouse_gene Serum albumin gene gene gene mouse Mus musculus Mouse ibp5_mouse_gene Insulin-like growth factor-binding protein 5 gene gene gene mouse Mus musculus Mouse kat5_mouse Histone acetyltransferase KAT5 Kat5 Htatip Tip60 Lysine acetyltransferase 5 Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein mouse Mus musculus Mouse MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW EACEE4D544C0DB60 cxcr4_mouse_gene C-X-C chemokine receptor type 4 gene gene gene mouse Mus musculus Mouse h2az_mouse Histone H2A.Z H2az1 H2afz H2az protein protein mouse Mus musculus Mouse MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV E024E53818230371 foxa2_mouse Hepatocyte nuclear factor 3-beta Foxa2 Hnf3b Tcf-3b Tcf3b Forkhead box protein A2 protein protein mouse Mus musculus Mouse MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS 2F20F15AB372F557 sox17_mouse_gene SOX17_MOUSE_GENE gene gene mouse Mus musculus Mouse wnt7a_mouse_gene Wnt7a gene gene gene mouse Mus musculus Mouse feta_mouse_gene Alpha-fetoprotein gene gene gene mouse Mus musculus Mouse foxa2_mouse_gene Hepatocyte nuclear factor 3-beta gene gene gene mouse Mus musculus Mouse apoa1_mouse_gene Apolipoprotein A-I gene gene gene mouse Mus musculus Mouse smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein Q3TKT4 original sequence version: 82 DIP protein Q3TKT4 original sequence version: 56 DIP protein Q3TKT4 original sequence version: 43 DIP protein Q3TKT4 original sequence version: 75 C23804ED858F98FE tthy_mouse_gene Transthyretin gene gene gene mouse Mus musculus Mouse np1l1_mouse Nucleosome assembly protein 1-like 1 NAP-1-related protein Brain protein DN38 Nap1l1 Nrp protein protein mouse Mus musculus Mouse MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ 48F17F3A44D9A597 foxa2-albu 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-albu-1 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-foxa2-1 1 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp. Fig. 2E foxa2-tthy 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-hnf4a 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Supp. Fig. 2E h2afz-foxa2-2 1 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-apoa1-1 1 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp. Fig. 2E foxa2-apoa1-1 1 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Supp. Fig. 2E h2afz-cxcr4-1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-cxcr4-1 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-feta-1 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-feta 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-ibp5 1 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Supp. Fig. 2E h2afz-ibp5 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-sox17 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-h2afz-1 1 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Supp. Fig. 2E foxa2-foxa2 1 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-foxa2 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Supp. Fig. 2E foxa2-wnt7a 1 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Supp. Fig. 2E h2afz-wnt7a 1 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp. Fig. 2E h2afz-foxa2 2 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Fig. 3D foxa2-h2afz 2 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Fig. 3D nap1l1-albu 3 18 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association Supp. Fig. 4A smarca4-albu 3 5 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 4A kat5-albu 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association Supp. Fig. 4A nap1l1-tthy 3 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Supp. Fig. 4A smarca4-tthy 3 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 4A kat5-tthy 3 17 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association Supp. Fig. 4A nap1l1-hnf4a 3 4 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Supp. Fig. 4A smarca4-hnf4a 3 16 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey association association Supp. Fig. 4A kat5-hnf4a 3 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey association association Supp. Fig. 4A nap1l1-apoa1 3 18 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-apoa1 3 16 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-apoa1 3 15 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-cxcr4 3 18 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 4A smarca4-cxcr4 3 8 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 4A kat5-cxcr4 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association Supp. Fig. 4A nap1l1-feta 3 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-feta 3 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-feta 3 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-ibp5 3 18 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-ibp5 3 16 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-ibp5 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-sox17 3 18 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Supp. Fig. 4A smarca4-sox17 3 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 4A kat5-sox17 3 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Supp. Fig. 4A nap1l1-foxa2 3 18 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association Supp. Fig. 4A smarca4-foxa2 3 16 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association Supp. Fig. 4A kat5-foxa2 3 7 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association Supp. Fig. 4A nap1l1-wnt7a 3 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-wnt7a 3 16 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-wnt7a 3 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression