IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-h1 H1 Human ES cell line h1 H1 Human ES cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. Cell (0092-8674) 2012 imex curation Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Accepted 2013-MAY-08 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation rl6_huma_gene 60S ribosomal protein L6 gene gene gene human Homo sapiens Human sir5_human NAD-dependent protein deacylase sirtuin-5, mitochondrial SIRT5 SIR2L5 Regulatory protein SIR2 homolog 5 SIR2-like protein 5 protein protein human Homo sapiens Human MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS 022DA32CDB43AC3A rl3_human_gene 60S ribosomal protein L3 gene gene gene human Homo sapiens Human rl6_mouse_gene 60S ribosomal protein L6 gene gene gene mouse Mus musculus Mouse rl23_human_gene 60S ribosomal protein L23 gene gene gene human Homo sapiens Human myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 myc_mouse Myc proto-oncogene protein Proto-oncogene c-Myc Transcription factor p64 Myc protein protein mouse Mus musculus Mouse MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA DIP protein P01108 original sequence version: 146 DIP protein P01108 original sequence version: 167 3FCA39BFFD6FC59E sir6_mouse NAD-dependent protein deacetylase sirtuin-6 Sirt6 Sir2l6 SIR2-like protein 6 Regulatory protein SIR2 homolog 6 protein protein mouse Mus musculus Mouse MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS 75FD950B42D68A1A rs15a_human_gene 40S ribosomal protein S15a gene gene gene human Homo sapiens Human rl23_mouse_gene 60S ribosomal protein L23 gene gene gene mouse Mus musculus Mouse sir6_human NAD-dependent protein deacetylase sirtuin-6 SIR2-like protein 6 SIRT6 SIR2L6 Regulatory protein SIR2 homolog 6 protein protein human Homo sapiens Human MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS DIP protein Q8N6T7 original sequence version: 100 DIP protein Q8N6T7-1 original sequence version: 105 DIP protein Q8N6T7 original sequence version: 137 0C86AAC497130BBF rs15a_mouse_gene 40S ribosomal protein S15a gene gene mouse Mus musculus Mouse sir2_human NAD-dependent protein deacetylase sirtuin-2 SIR2-like protein 2 SIRT2 SIR2L SIR2L2 Regulatory protein SIR2 homolog 2 protein protein human Homo sapiens Human MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTEREKPQ DIP protein Q8IXJ6 original sequence version: 113 A392442A8F6316F1 rl3_mouse_gene 60S ribosomal protein L3 genr gene gene mouse Mus musculus Mouse sirt6-myc 3 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 4E myc-sirt6-1 2 13 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4E sirt6-myc 6 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 4C sirt6-myc-2 4 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig. 4F sirt6-rl3 7 18 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl3 7 10 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 4D myc-rl6 7 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 4D sirt6-rl6 7 18 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl23 7 12 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 4D sirt6-rl23 7 18 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rs15a 7 16 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 4D sirt6-rs15a 7 16 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait association association Fig. 4D SIRT6 binding extended into the intragenic regions. sirt2-myc 6 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 4C sirt5-myc 6 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 4C sirt6-rl23-1 1 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rs15a-1 1 18 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rl3-1 1 18 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rl6-1 1 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait association association Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl3-2 5 14 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 5D myc-rl6-1 5 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 5D myc-rl23-1 5 17 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Supp. Fig. 5D myc-rs15a-1 5 14 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 5D