InnateDB InnateDB ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. Nat. Immunol. (1529-2908) 2013 imex curation Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Fetal liver–derived DCs. pellegrini@wehi.edu.au 26-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Ikbb PEST domain:-The reference given (no 34-McKinsey et al.) appears to refer to a Human protein,however, the sequence given (PCSSSSDSDGG) does not correspond to any protein in UniProt with 100% identity. Fetal liver–derived DCs. The authors have supplied construct origins. pellegrini@wehi.edu.au Accepted 2013-JUN-19 by MGT 26-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2013 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. Nat. Immunol. (1529-2908) 2013 imex curation Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Fetal liver–derived DCs. pellegrini@wehi.edu.au 26-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-dendritic cell Mouse dendritic cell dendritic_cell dendritic cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Fetal liver–derived DCs. pellegrini@wehi.edu.au Accepted 2013-JUN-19 by MGT 26-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2013 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ari2_mouse E3 ubiquitin-protein ligase ARIH2 Arih2 Ari2 Triad1 Uip48 Triad1 protein UbcM4-interacting protein 48 RING-type E3 ubiquitin transferase ARIH2 protein protein mouse Mus musculus Mouse MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALHEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHFQLQLCPGADCPMVIRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYERIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDFHDT B55EA54FE8C3ADAF ikbb_mouse NF-kappa-B inhibitor beta I-kappa-B-beta Nfkbib Ikbb protein protein mouse Mus musculus Mouse MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDEDDKLSPCSSSGSDSDSDNRDEGDEYDDIVVHSGRSQNRQPPSPASKPLPDDPNPA DIP protein Q60778 original sequence version: 86 0E2B46C89E2404EF arih2-nfkbib 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 6C MG132 (proteasomal inhibitor), LPS nfkbib-arih2 1 4 unspecified role unspecified role bait bait c_terminal_pest_domain required to bind necessary binding region required to bind certain certain sequence position certain undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6D MG132 (proteasomal inhibitor)