IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. Cell (0092-8674) 2012 imex curation Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. ChIP expts invovlinvg H3 could not be captured as this could not be described by a single UniProt entry. Interactions invovlivng the gene Delta could not be captured as this could not be unambiguously assigned to an official gene name. markg@fhcrc.org Accepted 2013-MAY-09 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. Cell (0092-8674) 2012 imex curation Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions drome-kc Drosophila melanogaster embryo KC cells kc Drosophila embryo KC cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. ChIP expts invovlinvg H3 could not be captured as this could not be described by a single UniProt entry. markg@fhcrc.org Accepted 2013-MAY-09 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. Cell (0092-8674) 2012 imex curation Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions drome-kc Drosophila melanogaster embryo KC cells kc Drosophila embryo KC cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org Accepted 2013-MAY-09 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. Cell (0092-8674) 2012 imex curation Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland confocal microscopy confocal microscopy immunostaining immunostaining Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org Accepted 2013-MAY-09 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. UpSET recruits HDAC complexes and restricts chromatin accessibility and acetylation at promoter regions. Cell (0092-8674) 2012 imex curation Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. markg@fhcrc.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions drome-kc Drosophila melanogaster embryo KC cells kc Drosophila embryo KC cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Rincon-Arano H., Halow J., Delrow J.J., Parkhurst S.M., Groudine M. Not 100% sure I've got everything in this paper - i think I've got all the ChIP data which obeys our rules (some is native) and is specific enough to be captured and I think I've got all colocalization which is not just involving markers but I'm not sure in either case. ChIP expts invovlinvg H3 could not be captured as this could not be described by a single UniProt entry. markg@fhcrc.org Accepted 2013-MAY-09 by MGT 17-Jun-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation cbp_drome_gene Sarcoplasmic calcium-binding protein gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly c15_drome_gene C15 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly orb_drome_gene Oo18 RNA-binding protein gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly neur_drome_gene Protein neuralized gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 ccna2_mouse_gene Cyclin-A2 gene gene gene mouse Mus musculus Mouse h4_drome Histone H4 H4 His4r H4r CG3379 His4:CG31611 CG31611 His4 His4:CG33869 His4:CG33871 His4:CG33873 His4:CG33875 His4:CG33877 His4:CG33879 His4:CG33881 His4:CG33883 His4:CG33885 His4:CG33887 His4:CG33889 His4:CG33891 His4:CG33893 His4:CG33895 His4:CG33897 His4:CG33899 His4:CG33901 His4:CG33903 His4:CG33905 His4:CG33907 His4:CG33909 CG33869 CG33871 CG33873 CG33875 CG33877 CG33879 CG33881 CG33883 CG33885 CG33887 CG33889 CG33891 CG33893 CG33895 CG33897 CG33899 CG33901 CG33903 CG33905 CG33907 CG33909 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P84040 original sequence version: 97 DIP protein P84040 original sequence version: 36 DIP protein P84040 original sequence version: 50 DF3EB26393BD208C q9vub5_drome upSET Dmel\CG9007 UpSET CG9007 Dmel_CG9007 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPMSSHDSVFVEPAVSSSGGGSTSSINRIGVASGPQPPPPHIVIDGSSLSTQAQLRIMQRRMSISTRQILSASQSQSINQSQKYAVRTAAGTGALAAGAASSGSSGQELINPQIYKIVTTDGSTSNVIIDASAAAPPHNSKLLLSNLTVLSKQAPVQGAAGQQQQQLNYLGAKSLPYVSASPAKTQQQPQKFGSISAFKAQHQQQQQHPHATLQKVTLGSRVATRLQSYVPASPSQIMVQPAQPKYVNATATTIGGNAALLKKANQKITVKSVSNMSQQQQQQQQQQQQQLLQAQQLKTFITQQQQQQTYKAGAKAKFVKQTTALSIAALPQQQQQTTYAKQSMVTTSTPAKVTKLNSKYVQQQISLPQGTQLQHKASPNVTGGGYLLQQSQAAVGGTIKFVNSHGTVIQQHPQQQQATKRTHYNSSGSSDNEQHAVANSSLITDDVMIVNGTQMTDELSARILQSMAQKSFSQQQRFHQVPATGSGNMPPPTQIIYSNSTSNGAAASSPGGNASGNMLLAHYQAAGTKPVSSASFITVTGTPPVTVATTPSVSISSHGFASGSAAISSYMSSATAARRQSVSAPSSRAVSLERKQHHQQLQHDVIGGGRKAPTVIEYYNKHGVNSIVGSSNNLAQSNSMSNLAGPRSNSGSGFATTTPTPATPLHLTPVNVPVHVEAAPPSSPALVKGSSQPPAQPQQQQQQAHPLGPNQLNANDEELYIEEVRPVPVLTQDLRLQQLHAIMQDHTYASQQQQQQPQQAAGDTTNPGAAQQVQQPQQWSLGGIGVTVSGSQGTPTAVGGYCSYFGQQIARSQADDDAHSAISSSSRMGLASTDIDPGEETETAPEAEAEDDSVTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVDKARARALQRQKRKEHMLLVATQAANGAAAVAAGTTLSGGLGSGLPMSEELQHRLASGLNGGFATGTGMSKKSKKTKENSGSTSTLKKTKKSAVGMGGEKNASGSGTPTGSSGKTSKKSSKRKSKSGGDGSSGGGSSPALTAAEKHAANLRQWIENYEYAVTNHYSPELRARLHAIQKQPSLLQSIQNTENKALRQIQQQLSTAGSAEQLEQRAQLIPYAGAKVLISSVDLSPHAPIHELRGKYMLTTQFRTQNPTVNMNTPPPSNYLNSFKAHKTPGQFVFFYQLPGVEAPMQTLRPDGSVPQVAQQPPSYLKGPEVCVDTRTYGNDARFVRRSCRPNAELQHYFEKGTLHLYIVALTHIRAQTEITIRHEPHDLTAVEQKKSHAAVIQPTSTRCACDMGSDCLFALPLAVQQQLQAPPTQPRSSHRNKAAAAAAAAAAANSAAAIQLTMGLGVGATVAAGASVLPNSRNRSTSSSGESSQMGLNSPQLGQLNLGFKTSVTATSLTAPVPGVHCNNSGGSSSSSNNSCSVSMSSVLHDSGICTSSSSPSVSIPSPTPTQMQSPTLQQHPQQIPQQQLSLLQRSPTQQHQQQILAALPTPMLTPMLSPQLPKPAQQQAHVVLPQSQQTSLLQQQQSQQSQEPLAVIAAAAAAQQPMATYFVRQPQQQQQQQSPKPQALVAQQQHVVGAQQQQHFLQQQQKQQQQQMADEARMAVSALQTLHAAPTSHIVSPIKVAAVQQQSQPQQQQQNTHQQPHNQQAVQQQSNQLQQQQSQQPNYPQSPQRQQKPQPVQHQPQIVISTGAQAIPATMPTKLSSPTKSAAPVISNNNITVSAQSSVVGGKKTPAKHPQQQQQQQQQPVTPVSAATAPAATPSSSESKEDDVSASSTTTPTTRTPAKDKPKQSREDRKLEAILRAIEKMEKQEARGKKDTRQSSGGKRQASNSPASPNKRNSSNSISEDVETPTSTNSAAAAAQRRNKKKRKVSRSLNNNTNGLGSGGGSNNKRRKSIVVESDGESHALTNSESEDQGQHPQSHHSGSEDQAAGLLLALAHNNSSPNEPFKSPLSQSHSLPATPASVSSACLLIEAAMGPLQQQPAPASASPSLAEFKYPPGGAKTKKSLMSSWFQQAEQQHASGLDSLVQAAMSEINGEREQLQRQPQGESLPAPALLKVEQFIHQAESTTAVPAREQLHLPLQNNSSVKKRWLRQAISEETTPVDELQQSQNQSVTATPSPQPVPTVSPLANGFSTPLKKRRLVVVSNGTNVESDETHIDVIGEPKDEAEENVAMTELKVEIENHHQEQDDDVDILRSPSPGTHQIVAEDNLVKIEPEDTSAAADDVKIDVEREESQACDKFEEMVKVKREEEEQREKEIKQLQERQEHEQPKVEPAPVEPKLENTVAKAEPKVEPSQEIVSKKEPTKVEPKPGESLLRSTATVTATPTAATIAATTLLDVSKVAFKTRPPLKLEDEPQKKKPKLESILPAPVATVPPVSVPPIPAASNATTSAVTNTAAASLTTTTAPSSTKNLTEHDIQERLLSFHAANISYLQSRNKKATAALTSASPSQKSNSSSGGSGTESKKSSKDKDEKRDKEKQLKKSKKEKKKSKDKEKQKAAVNVNSTSQIVDTKKKTTQPSKPDSKSSIAPVLVPPSLPVATANGKTKHTAYNNVDQQQQQQMRRRTMSMCITPVTPTPVVTPSPLHGTPPSTKKRQTNFEQELTKPNSQILSSSILLNSSKGLGLPLAAPTVVSVPTAVQQQQHRKENNHQEATPASGGPMSLAAAIASGKLNAISRRRESMCGSRQQQALIAAALKKEKKEKKKSKKKDREKQKHDKQKGKEKEREKDKEKDNKQKTNHIQKPAHPTTVPANSMPISAPAPVPVLVPTPVTTPKAAPIPVLITQPTPSPIHVTQPLVNNCSTKVASLPFYNTIYGKLQDPSTPTSSPIPVTNTMPSLAEYLESTKSKTTALSAVKPIGIAAVTPLSSAITPAKVAPSSLEMPPPATTPLKLYTRTASHDPRLNPMLTVPDPTPMPKRKLSISEYRMRHRPSVDTAPTTPTTPTTPTTPTTPPGSNKDRSFAKPQTINKCSLQSPERFQAAIRERRNSISAHHPQQNAHHNLNNNKGGISNKSGSSSGNHLQQALGVAGGRLQSKNAIVDPAATTLSTVNSILSTAQKLHMFDDKPKGGHFNAAPTLLEQQQEKMSERSRCLQRTISCDSRVIERLGTGAAAGALEKVTTASTRRDAV 81EEAC5C308FEC31 q5u0y0_drome Sin3A 15 159A11T 27 3 97 Dmel\CG8815 ES2-3 ESTS:159A11T EY2-9 SIN3 SIN3A Sin 3A Sin3 Sin3a dSin3 dSin3A l(2)08269 l(2)k02703 l(2)k05415 l(2)k09715 ld sin3 sin3A sin3a sni3 CG8815 Dmel_CG8815 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMKRTRVDEVQFGTRPVPQTSGGVGVGVVGVTGGGPTSGGGGTATVGVNTTGVTIGTVVPSAHNATISGIGSIHHRILTPQHGGAQTIAYLPSTTPTATNLKTTTSIVDSTTAGGPVGAGAQVAVGVGSAAGGGGVVVSTGSTGTQTLQYTTSYSVASIQAGGTLKANTADGANTVQIHVTGGGAANNPASAQTVSSSSQTGTIRQRTISGTQTVATAVGNLATISQQQPVQQSPLGKAQTPPSSVVANSIPVGGTTPPQGQSGNATPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVHMLTGNSSMSGAGHIAIKTTNAATLTPAAGAGAAAAAAAVAQIQSAGAVNLMTHGGASLTQTTIHALQQATPPQSQSPGGGHVHVSVTNSTAANAVVPGQPGISVSAHNVPQNYSRDRERATITPTGQVAGAAANVNASASIVVGGPPTPNSLSELSPHGGAGGGPGAGAAQHNLHHIQQAHQSILLGETGQQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDATNHQSGQYMSKSASVHNDHGKRPTATLSGGAHITMSSASPAPSGSPLHLGATTLPQIDKSAHAAAIGNLSAVNTSVSIKTYNNNQQQQNHVIGSGLNATRNDILFEKDYHAGLQQQAHQRGAGVGGHHHLAGTAAGANIGRPGVGASVMVSYDKEHRNNHHVQKYVGHAPNQNLTHGHNAKKSPSYGIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEASSKCTISDAAFFDKVRKALRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGPPSGQPAGGLIDGMPLAATQRQGGGSSNSSHDRGTSHQSAAEYVQDVDLSSCKRLGASYCALPQSTVPKKCSGRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNEIETLYDERHDQEDDAMEPFGPHLVLPYKDKTILDDAANLLIHHVKRQTGIQKQEKQKIKQIIRQFVPDLFFAPRQPLSDDERDDAFPFLVDDNTKMDVDSPLGRTESSTRNAKSTPSESASPARSNASTSSVTPAGIKKETDDSKATTGSFAPASSATASSATPVDDATPSTSSAAAAASAASSSTVSGTEGKPKDDPLSSHKEEGAGSTSSGVATSPRQAQDTAGAGVDVEIKLEHPADFSNPKLLPPHAHGQREDESYTLFFANNNWYLFLRLHAILCDRLHVMYERARLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQYCVTERAALDCVELFATEQRRGCTGGFCRDAHKTFDREMSYQRKAESILNEENCFKVYIYKIDCRVTIELLDSEPEEVDKPAALKAQKFSKYVERLANPALGGGGNTGRSDSALGNDSVVDGSDIKTEADEDTAELRYREGGIGGAGKARFLVRNKRRSKLLEEQVRQLFEHRRNRIEQHGTAASLEPISVDSAISSNSTTGGGGSGTNNNNNNNNNNNSWGGKRLERLGAPQVGLAEQYAFNDRDEISTNISNGRCFVTSKNLKLLKYDAVRRAKKSHCRVTQAKYAHFQTYVNKWLQQHVSEQQQQNCVDWLLGKTADQINASGWGSASKTKTVQQKDTSKTPYRIYNRYRVVQSAVSGGLMSATAPTPDGSVPAVNSAPSGSVSTVNNVQGSAAVSSTSHSMCNSSILSADSTTNTNASAQQQQHCNSAAAATTPNAEALQQVRPMES E84EB062EFCA1B5F hdac1_drome Histone deacetylase HDAC1 HDAC1 Rpd3 CG7471 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASNTNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI DIP protein Q94517 original sequence version: 67 B0F6503D42A1BCE9 nfkb1_drome_gene Nuclear factor NF-kappa-B p110 subunit gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly cplx_drome_gene Complexin gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly suh_drome_gene Suppressor of hairless gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly dl_drome_gene Neurogenic locus protein delta gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly co4a1_drome_gene Collagen alpha-1(IV) chain gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly notch_drome_gene Neurogenic locus Notch gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly cpo_drome_gene Protein couch potato gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly vkg_drome_gene Viking gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly sin3a-q9vub5 3 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Fig. 3H rpd3-q9vub5 3 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 3H q9vub5-sin3a 4 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3 E,F q9vub5-rpd3 4 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3 D,G rpd3-sin3a-1 2 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D rpd3-notch 2 21 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Fig. 4C Levels of Rpd3 at the promoter level of this gene decreased in UpSET (Q9VUB5) -/- cells rpd3-nfkb1 2 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4C Levels of Rpd3 at the promoter level of this gene decreased in UpSET (Q9VUB5) -/- cells rpd3-orb 2 15 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4C Levels of Rpd3 at the promoter level of this gene decreased in UpSET (Q9VUB5) -/- cells rpd3-suh 2 18 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Fig. 4C rpd3-c15 2 7 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Fig. 4C sin3a-nfkb1 2 16 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Fig. 4D sin3a-suh 2 18 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait association association Fig. 4D sin3a-c15 2 14 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4D his4r-vkg 2 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain 23 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3B Levels of H4K17Ac at the promoter level of this gene increased in UpSET (Q9VUB5) -/- cells his4r-cplx 2 17 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp. Fig. 3B Levels of H4K17Ac at the promoter level of this gene increased in UpSET (Q9VUB5) -/- cells his4r-cpo 2 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain 22 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3B his4r-cbp 2 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3B Levels of H4K17Ac at the promoter level of this gene increased in UpSET (Q9VUB5) -/- cells his4r-co4a1 2 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3B Levels of H4K17Ac at the promoter level of this gene increased in UpSET (Q9VUB5) -/- cells his4r-dl 5 19 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp. Fig. 3D his4r-suh-1 5 18 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp Fig. 3D his4r-orb-1 5 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp. Fig. 3D Levels of H4K17Ac at the promoter level of this gene increased in UpSET (Q9VUB5) -/- cells his4r-nfkb1-1 5 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3D his4r-neur-1 5 9 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp Fig. 3D his4r-c15 5 7 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp. Fig. 3D hist1h4h-ccna2 1 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait lys-17 n2aclys N2-acetyl-L-lysine (2S)-2-acetamido-6-aminohexanoic acid 2-acetylamino-6-aminohexanoic acid 2-acetylazanyl-6-azanylhexanoic acid N2-acetyl-L-lysine N2-acetylated L-lysine N2-acetyllysine Acetyl N2AcLys certain certain sequence position certain certain certain sequence position certain association association Supp. Fig. 4C rpd3-dl 2 19 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Fig. 4C Levels of Rpd3 at the promoter level of this gene decreased in UpSET (Q9VUB5) -/- cells sin3a-neur 2 9 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Fig. 4C Levels of Rpd3 at the promoter level of this gene decreased in UpSET (Q9VUB5) -/- cells