InnateDB InnateDB The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. Nat. Immunol. (1529-2908) 2012 imex curation Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu Accepted 2013-JUL-29 by PPORRAS 02-Aug-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. Nat. Immunol. (1529-2908) 2012 imex curation Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-d2sc Mouse splenic myeloid dendritic cell d2sc mouse splenic myeloid dendritic cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu Accepted 2013-JUL-29 by PPORRAS 02-Aug-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. The helicase DDX41 recognizes the bacterial secondary messengers cyclic di-GMP and cyclic di-AMP to activate a type I interferon immune response. Nat. Immunol. (1529-2908) 2012 imex curation Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Parvatiyar K., Zhang Z., Teles R.M., Ouyang S., Jiang Y., Iyer S.S., Zaver S.A., Schenk M., Zeng S., Zhong W., Liu Z.J., Modlin R.L., Liu Y.J., Cheng G. Interaction invovling tagged STING and tagged DDX41 were not annotated because no species information was provided in this publication or the cited reference (ref. 17) gcheng@mednet.ucla.edu Accepted 2013-JUL-29 by PPORRAS 02-Aug-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity sting_mouse Stimulator of interferon genes protein Sting1 Endoplasmic reticulum interferon stimulator Eris Mediator of IRF3 activation Mita Mpys Tmem173 Transmembrane protein 173 protein protein mouse Mus musculus Mouse MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9WUN2 original sequence version: 53 DIP protein Q9WUN2 original sequence version: 101 DIP protein Q9WUN2 original sequence version: 100 DIP protein Q9WUN2 original sequence version: 93 978ADDE3061DACD1 ddx41_mouse Probable ATP-dependent RNA helicase DDX41 DEAD box protein 41 Ddx41 protein protein mouse Mus musculus Mouse MEDSEPERKRARADEATAGGSRSEDEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGATEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF 85829CA9BDD0F4E1 ddx41-tmem173 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 5A c-di-GMP or c-di-AMP tmem173-tbk1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 5B c-di-GMP or c-di-AMP. ddx41-tmem173-1 3 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4A ddx41-tmem173-2 1 4 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. S4B