InnateDB InnateDB Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Nat. Immunol. (1529-2908) 2012 imex curation Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Accepted 2015-MAR-25 by PPORRAS Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Nat. Immunol. (1529-2908) 2012 imex curation Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Accepted 2015-MAR-25 by PPORRAS Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. Nat. Immunol. (1529-2908) 2012 imex curation Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Accepted 2015-MAR-25 by PPORRAS Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity il2rb_human Interleukin-2 receptor subunit beta IL2RB High affinity IL-2 receptor subunit beta p70-75 Interleukin-15 receptor subunit beta IL15RB protein protein human Homo sapiens Human MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV DIP protein P14784 original sequence version: 170 DIP protein P14784 original sequence version: 147 1A76FA1936BB7EE6 il15_human Interleukin-15 IL15 protein protein human Homo sapiens Human MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 0CE0520C1D8379E2 il2rg_human Cytokine receptor common subunit gamma IL2RG p64 gammaC Interleukin-2 receptor subunit gamma protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET 3B6215246D610215 i15ra_human Interleukin-15 receptor subunit alpha IL15RA protein protein human Homo sapiens Human MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL A9CFC885189E96BE il15-il15ra-3 1 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P31785:p.Ser53Asp mutation mutation certain certain sequence position certain certain certain sequence position certain S D Wed May 02 15:43:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53asp' Tue Jun 30 17:23:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Asp' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P14784:p.[Ala3Asp;Leu17Asp;Ser45Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain A D certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain S D Wed May 02 19:51:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala3asp,leu17asp,ser45asp' Tue Jun 30 19:04:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala3Asp;Leu17Asp;Ser45Asp]' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role neutral component neutral component region his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table 1, Fig. 1. 2.35A Rwork = 19.2 Rfree = 24.2 il2rb-il15-3 3 4 unspecified role unspecified role bait bait purified purified biotinylated bap tag biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Fig. 4A il2rb-il15-1 3 4 unspecified role unspecified role bait bait biotinylated bap tag biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 4A il15-il15ra-4 2 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P31785:p.Ser53Asp mutation mutation certain certain sequence position certain certain certain sequence position certain S D Wed May 02 15:41:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53asp' Tue Jun 30 16:06:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Asp' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P14784:p.[Ala3Asp;Leu17Asp;Ser45Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain A D certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:59:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala3asp,leu17asp,ser45asp' Tue Jun 30 18:47:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala3Asp;Leu17Asp;Ser45Asp]' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. S1A