UniProt UniProt http://www.uniprot.org Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. J. Virol. (0022-538X) 2012 imex curation Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 Only protein-protein interactions imex curation Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. J. Virol. (0022-538X) 2012 imex curation Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 Only protein-protein interactions imex curation Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. J. Virol. (0022-538X) 2012 imex curation Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 Only protein-protein interactions imex curation Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. J. Virol. (0022-538X) 2012 imex curation Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. MAVS-/- mouse embryonic fibroblasts (MEF) have been used. xibao@utmb.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 Only protein-protein interactions imex curation Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. Human metapneumovirus M2-2 protein inhibits innate cellular signaling by targeting MAVS. J. Virol. (0022-538X) 2012 imex curation Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ren J., Wang Q., Kolli D., Prusak D.J., Tseng C.T., Chen Z.J., Li K., Wood T.G., Bao X. xibao@utmb.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 Only protein-protein interactions imex curation mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH 0E23E3E115941EE8 vglg_hmpvc Major surface glycoprotein G G Attachment glycoprotein G Membrane-bound glycoprotein protein protein hmpvc Human metapneumovirus (strain CAN97-83) MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSSESEHHTSSPPTESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPASTPDTTNRLSSVDRSTAQPSESRTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMSSTGKRPTTTSVQSDSSTTTQNHEETGSANPQASVSTMQN 5BB6EF50C14FF917 m22_hmpvc Protein M2-2 M2 protein protein hmpvc Human metapneumovirus (strain CAN97-83) MTLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS 0887B853B81A8125 ddx58_human Antiviral innate immune response receptor RIG-I DEAD box protein 58 Retinoic acid-inducible gene 1 protein DDX58 Probable ATP-dependent RNA helicase DDX58 Retinoic acid-inducible gene I protein RIG-I-like receptor 1 protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK BF0D501C395BAE25 m2-mavs-1 1 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A m2-mavs-2 1 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A mavs-m2 2 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B mavs-m2-1 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey infection infection physical association physical association 2D ddx58-g 5 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C g-mavs 4 6 unspecified role unspecified role prey prey region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C