IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. emailed author as origin of malfgk complex not clear. erwin.schneider@rz.hu-berlin.de Accepted 2013-DEC-04 by ORCHARD Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de Accepted 2013-DEC-04 by ORCHARD Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atpase assay atpase assay autoradiography autoradiography Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. The ATPase assays were conducted in proteoliposomes constructed from the UgpAEC or MalFG-UgpC complex and total E. coli phospholipids in detergent and subsequent removal of the detergent by adsorption to hydrophobic beads. UgpB/G3P and MalE/maltose, respectively, were either added prior to proteoliposome formation and enclosed into its lumen or added afterwards to the medium. In the latter case, Mg2+ ions were added to the medium to permealise the proteoliposomes and allow ATP access to the lumen. ATPase activity was initiated by the addition of ATP (in some cases [gamma-32P]ATP) and measured by assaying the release of inorganic phosphate. erwin.schneider@rz.hu-berlin.de Accepted 2013-DEC-04 by ORCHARD Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de Accepted 2013-DEC-04 by ORCHARD Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. The ATPase assays were conducted in proteoliposomes constructed from the UgpAEC or MalFG-UgpC complex and total E. coli phospholipids in detergent and subsequent removal of the detergent by adsorption to hydrophobic beads. UgpB/G3P and MalE/maltose, respectively, were either added prior to proteoliposome formation and enclosed into its lumen or added afterwards to the medium. In the latter case, Mg2+ ions were added to the medium to permealise the proteoliposomes and allow ATP access to the lumen. ATPase activity was initiated by the addition of ATP (in some cases [gamma-32P]ATP) and measured by assaying the release of inorganic phosphate. erwin.schneider@rz.hu-berlin.de Accepted 2013-DEC-04 by ORCHARD Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation malf_ecoli Maltose/maltodextrin transport system permease protein MalF malF b4033 JW3993 protein protein ecoli Escherichia coli (strain K12) MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD DIP protein P02916 original sequence version: 123 DIP protein P02916 original sequence version: 114 895CEA1986CE5C0B male_ecoli Maltose/maltodextrin-binding periplasmic protein malE MMBP Maltodextrin-binding protein Maltose-binding protein JW3994 b4034 protein protein ecoli Escherichia coli (strain K12) MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK DIP protein P0AEX9 original sequence version: 88 DIP protein P0AEX9 original sequence version: 77 A4C1B3C1777ADE47 ugpc_ecoli sn-glycerol-3-phosphate import ATP-binding protein UgpC ugpC b3450 JW3415 protein protein ecoli Escherichia coli (strain K12) MAGLKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGDIWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFIGSPAMNLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHIALSSQAEGGVPMVMDTLEILGADNLAHGRWGEQKLVVRLAHQERPTAGSTLWLHLAENQLHLFDGETGQRV 33D49B258D0C9AA8 malg_ecoli Maltose/maltodextrin transport system permease protein MalG JW3992 b4032 malG protein protein ecoli Escherichia coli (strain K12) MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG DIP protein P68183 original sequence version: 76 DIP protein P68183 original sequence version: 67 E54418E91E344A29 ugpa_ecoli sn-glycerol-3-phosphate transport system permease protein UgpA ugpA b3452 JW3417 protein protein ecoli Escherichia coli (strain K12) MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFVTLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSGGPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ CC8765DE0FB647A9 sn-glycerol 3-phosphate sn-glycerol 3-phosphate (R)-glycerol 1-phosphate D-(glycerol 1-phosphate) Glycerol-3-phosphate Glycerophosphoric acid L-(glycerol 3-phosphate) phosphoric acid mono-((R)-2,3-dihydroxy-propyl) ester Phosphorsaeure-mono-((R)-2,3-dihydroxy-propylester) sn-Glycerol 3-phosphate SN-GLYCEROL-3-PHOSPHATE sn-Gro-1-P (2R)-2,3-dihydroxypropyl dihydrogen phosphate sn-glycerol 3-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) AWUCVROLDVIAJX-GSVOUGTGSA-N AWUCVROLDVIAJX-GSVOUGTGSA-N ugpb_ecoli sn-glycerol-3-phosphate-binding periplasmic protein UgpB ugpB b3453 JW3418 protein protein ecoli Escherichia coli (strain K12) MKPLHYTASALALGLALMGNAQAVTTIPFWHSMEGELGKEVDSLAQRFNAENPDYKIVPTYKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQFVPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLKASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEMNKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFYEKNPGADTATRQMLNKPPLPFTKGLRLGNMPQIRVIVDEELESVWTGKKTPQQALDTAVERGNQLLRRFEKSTKS E0B9B5885B240C8D E0B9B5885B240C8D malk_ecoli Maltose/maltodextrin import ATP-binding protein MalK malK b4035 JW3995 protein protein ecoli Escherichia coli (strain K12) MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV DIP protein P68187 original sequence version: 98 DIP protein P68187 original sequence version: 87 240D58F59450F30E maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ugpe_ecoli sn-glycerol-3-phosphate transport system permease protein UgpE ugpE b3451 JW3416 protein protein ecoli Escherichia coli (strain K12) MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHNIWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIATGEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK 16CEE371D329C10B sn-glycero-3-phosphocholine glycerol-3-phosphocholine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) vanadium oxoanion vanadium oxoanion Vanadate vanadium oxoanion vanadium oxoanions small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ugpb-sn_glycerol_3_phosphate 2 11 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role bait bait P0AG80:p.Leu172Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S Wed May 02 15:34:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu172ser' Tue Jun 30 18:37:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu172Ser' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0AG80:p.Trp169His mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W H Wed May 02 18:39:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp169his' Tue Jun 30 16:13:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp169His' P0AG80:p.Trp169Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W S Wed May 02 16:24:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp169ser' Tue Jun 30 15:49:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp169Ser' P0AG80:p.Leu172His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L H Wed May 02 19:15:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu172his' Tue Jun 30 18:23:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu172His' 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a, d, e ugpb-gpc 2 17 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2b ugpb-sn_glycerol_3_phosphate-1 4 12 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 3a, b, c R = 0.16, Rwork = 0.1, Rfree = 0.19 1.8 A ugpc-ugpa 1 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig. 1, 4c Pulldown in Fig. 4b is after reconstitution of the complex in proteoliposomes. ugpc-malf 1 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig. 1, 4b Pulldown in Fig. 4b is after reconstitution of the complex in proteoliposomes. malk-malf 1 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig. 1 ugpc-ugpa 5 15 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 11 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 12 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 10 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 18 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) atpase reaction atpase reaction Fig. 4b P0AG80 and CHEBI:15978 increases activity of P10907. CHEBI:30528 decreases activity of P10907. ugpc-malf 5 18 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 14 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 15 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 9 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Fig. 4b P0AEX9 and CHEBI:17306 increases activity of P10907. CHEBI:30528 decreases activity of P10907. ugpc-ugpa-1 5 15 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 10 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Fig. 4b Without UgpB and G3P only residual ATPase activity is observed. ugpc-malf-1 5 15 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Fig. 4b Without UgpB and G3P only residual ATPase activity is observed. ugpc-ugpa-32p 3 12 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 15 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Fig. 5b, c CHEBI:37586 causes no change to P10907. P10908 causes no change to P10907. P0A9K7 causes no change to P10907. ugpc-ugpa-32p-1 3 10 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) 15 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Fig. 5b, c Without UgpB and G3P only residual ATPase activity is observed.