MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. EMBO J. (0261-4189) 2012 imex curation Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. EMBO J. (0261-4189) 2012 imex curation Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy. EMBO J. (0261-4189) 2012 imex curation Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Kraft C., Kijanska M., Kalie E., Siergiejuk E., Lee SS., Semplicio G., Stoffel I., Brezovich A., Verma M., Hansmann I., Ammerer G., Hofmann K., Tooze S., Peter M. claudine.kraft@univie.ac.at Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation vac8_yeast Vacuolar protein 8 VAC8 YEB3 YEL013W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSCCSCLKDSSDEASVSPIADNEREAVTLLLGYLEDKDQLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRQVSREVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANILDALIPMTFSQNQEVSGNAAAALANLCSRVNNYTKIIEAWDRPNEGIRGFLIRFLKSDYATFEHIALWTILQLLESHNDKVEDLVKNDDDIINGVRKMADVTFERLQRSGIDVKNPGSNNNPSSNDNNSNNNDTGSEHQPVEDASLELYNITQQILQFLH B2E75774B47E5933 B2E75774B47E5933 atg1_yeast Serine/threonine-protein kinase ATG1 ATG1 APG1 AUT3 YGL180W G1615 CVT10 Autophagy-related protein 1 Autophagy protein 3 Cytoplasm to vacuole targeting protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGDIKNKDHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIGFEEFFANKVVNEDLSSYELEDDLPELESKSKGIVESNMFVSEYLSKQPKSPNSNLAGHQSMADNPAELSDALKNSNILTAPAVKTDHTQAVDKKASNNKYHNSLVSDRSFEREYVVVEKKSVEVNSLADEVAQAGFNPNPIKHPTSTQNQNVLLNEQFSPNNQQYFQNQGENPRLLRATSSSSGGSDGSRRPSLVDRRLSISSLNPSNALSRALGIASTRLFGGANQQQQQQQITSSPPYSQTLLNSQLFHELTENIILRIDHLQHPETLKLDNTNIVSILESLAAKAFVVYSYAEVKFSQIVPLSTTLKGMANFENRRSMDSNAIAEEQDSDDAEEEDETLKKYKEDCLSTKTFGKGRTLSATSQLSATFNKLPRSEMILLCNEAIVLYMKALSILSKSMQVTSNWWYESQEKSCSLRVNVLVQWLREKFNECLEKADFLRLKINDLRFKHASEVAENQTLEEKGSSEEPVYLEKLLYDRALEISKMAAHMELKGENLYNCELAYATSLWMLETSLDDDDFTNAYGDYPFKTNIHLKSNDVEDKEKYHSVLDENDRIIIRKYIDSIANRLKILRQKMNHQN 7F4C785AA3A7CC46 7F4C785AA3A7CC46 atg13_yeast Autophagy-related protein 13 ATG13 APG13 YPR185W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAEEDIEKQVLQLIDSFFLKTTLLICSTESSRYQSSTENIFLFDDTWFEDHSELVSELPEIISKWSHYDGRKELPPLVVETYLDLRQLNSSHLVRLKDHEGHLWNVCKGTKKQEIVMERWLIELDNSSPTFKSYSEDETDVNELSKQLVLLFRYLLTLIQLLPTTELYQLLIKSYNGPQNEGSSNPITSTGPLVSIRTCVLDGSKPILSKGRIGLSKPIINTYSNALNESNLPAHLDQKKITPVWTKFGLLRVSVSYRRDWKFEINNTNDELFSARHASVSHNSQGPQNQPEQEGQSDQDIGKRQPQFQQQQQPQQQQQQQQQQQRQHQVQTQQQRQIPDRRSLSLSPCTRANSFEPQSWQKKVYPISRPVQPFKVGSIGSQSASRNPSNSSFFNQPPVHRPSMSSNYGPQMNIEGTSVGSTSKYSSSFGNIRRHSSVKTTENAEKVSKAVKSPLQPQESQEDLMDFVKLLEEKPDLTIKKTSGNNPPNINISDSLIRYQNLKPSNDLLSEDLSVSLSMDPNHTYHRGRSDSHSPLPSISPSMHYGSLNSRMSQGANASHLIARGGGNSSTSALNSRRNSLDKSSNKQGMSGLPPIFGGESTSYHHDNKIQKYNQLGVEEDDDDENDRLLNQMGNSATKFKSSISPRSIDSISSSFIKSRIPIRQPYHYSQPTTAPFQAQAKFHKPANKLIDNGNRSNSNNNNHNGNDAVGVMHNDEDDQDDDLVFFMSDMNLSKEG 45CD16F69B795E62 45CD16F69B795E62 atg17_yeast Autophagy-related protein 17 ATG17 APG17 YLR423C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP 71504B6C76549B75 71504B6C76549B75 atg29_yeast Autophagy-related protein 29 P2540 YPL166W ATG29 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIMNSTNTVVYIKVKGRRPQGFLDPPKFEWNGTKERQLWTMVSNLNYSQDQIDWQNLSKIFETPEFFLKKRTYKLFAEHLELLQLQLEKKRDLEKYSNDQVNEGMSDLIHKYTPTLQNDNLLNVSASPLTTERQDSEEVETEVTNEALQHLQTSKILNIHKKTSDSENKPNDKLDKDGINKEMECGSSDDDLSSSLSVSKSALEEALMDRLQF E620EF94CF662BD4 E620EF94CF662BD4 atg11_yeast Autophagy-related protein 11 Cytoplasm to vacuole targeting protein 9 ATG11 CVT9 YPR049C YP9499.07c protein protein yeast Saccharomyces cerevisiae Baker's yeast MADADEYSTAPTQQEITPLQTTATIINAISGECITTNVDFFVSLDKFKQFIARKWKIPPDQLLILLPYGNKLKPSMFKELLINRSFTLNDFYVYDRRLFSLVSKPTPTNLLTSKDSNPMNSPNSNDLTETLEYLIKNSHISQYQGSDTIMIKPMPSPLEDADVDLSRLNYHSVTSLLTTNLGWLSALEIDVHYFKSLIPDIIAHIKRIFDGLTVCSQYLKLYCFDVESLYNSNVQFLNQLVDNGMTSKWEKCFNDTLSKLTALEGDSLQKFINIESLLENEKSVKILNHSINGKLNKIKREIDENASFRDIITVNIDRLRQMFTPNESKFELEDQMAESFEVLVSEMRTRSRNVLDKEEEEFNSQEFLKSMNVMLEKDKKESVKTLFTISQALYSQIGELIDLKKSLQKHAVAILGNIAFTQMEILGIKRLLLNECNKDLELYKKYEVEFAQVEDLPLIYGLYLIEKYRRLSWFQQILSFISNFNQDLELFKQNELRTRNKWVKNFGSIATVFCEDLLSSSDFKRLNEYHSHTSPPNEDEEDENENSIANYRQDLVKVSQAIDNYMTQIKETDVSEPIIDLLSKTLFETKRFHIIYSNFKNNNNNSSNGNSISPEGSIALKSDDVVKGYKTRIKKLESLLHEFQYSDIGHWPQGVLNTHLKPFRGSATSINKKKFLGASVLLEPANISEVNIDSVSQANNHQIQELESNVDDLLHQLQLLKEENNRKSMQISEMGKKISDLEVEKTAYRETLTNLNQELARLTNEEQSHRTEIFTLNASFKKQLNDIISQDNEKIEKLTGDYDDVSKSRERLQMDLDESNKKHEQEVNLLKADIERLGKQIVTSEKSYAETNSSSMEKGEKFETIPLAEDPGRENQISAYTQTLQDRIFDIISTNIFILENIGLLLTFDNNNNIQIRRVKGLKKGTAQSNILDESTQMLDAHDNSLIKSPVFQKLKDEYELIKSVANGSEKDTQQSIFLGNITQLYDNKLYEVAVIRRFKDIETLAKKLTKENKIKRTLLERFQREKVTLRNFQIGDLALFLPTRENVNSVGSMSSSTSSLSSSFSSVDLSTPPPLDAMSIQSSPSVIHSNVINQASISGRDKNKLMRPWAAFTAFEESTRYFLKDEKGLTKGKEWFVGRIVTLEHFVADSPSNNPFRLPKGSVWFQVTAVVVSYQGV A904B92E9AE79449 A904B92E9AE79449 atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 atg1-atg13-1 2 Atg13 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:05:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:22:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 19:58:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:05:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:07:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 15:57:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf1a sf3a atg1-atg13-1 2 Atg13 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06628:p.Phe468Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:49:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:11:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 16:22:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' Atg1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf1a atg1-atg13-1 1 Atg13 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:23:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:47:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 18:20:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:23:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:02:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 17:30:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' Atg1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b atg8-atg1 1 Atg8 10 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:42:20 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Val432 undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:42:22 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Glu433 direct interaction direct interaction f2b atg8-atg1-1 1 Atg8 10 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:18:32 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Glu433 undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:18:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Glu428 undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:18:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Phe429 direct interaction direct interaction f2b atg8-atg1-2 1 Atg8 10 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c atg1-atg13-1 3 Atg17 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:14:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:37:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 15:46:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:14:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:08:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 19:36:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' association association f1c atg1-atg13-1 3 Atg29 8 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:52:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:35:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 19:16:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:12:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:24:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 17:59:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' association association f1c atg1-atg13-1 3 Vac8 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:12:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:37:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 17:24:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:11:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:32:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 15:45:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f1c atg1-atg11-1 3 Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:52:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:28:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 15:40:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:11:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:55:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 16:25:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg11 9 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association sf1b atg1-atg13-1 3 Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1d atg1-atg13-1 3 Atg1 5 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Atg13 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06628:p.Val469Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:09:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:30:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val469ala' Tue Jun 30 18:31:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val469Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06628:p.Phe468Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:51:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:04:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe468ala' Tue Jun 30 20:06:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe468Ala' physical association physical association f1e f2d