IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Biochemistry (0006-2960) 2012 imex curation Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down anti tag western anti tag western blot anti tag western Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu Accepted 2013-MAY-13 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2012 Only protein-protein interactions imex curation Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Biochemistry (0006-2960) 2012 imex curation Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu Accepted 2013-MAY-13 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2012 Only protein-protein interactions imex curation Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export. Biochemistry (0006-2960) 2012 imex curation Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Freinkman E., Okuda S., Ruiz N., Kahne D. kahne@chemistry.harvard.edu Accepted 2013-MAY-13 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochemistry (0006-2960) 2012 Only protein-protein interactions imex curation lptc_ecoli Lipopolysaccharide export system protein LptC lptC b3199 JW3166 yrbK protein protein ecoli Escherichia coli (strain K12) MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP F6BAE79EA232CD95 lpte_ecoli LPS-assembly lipoprotein LptE lptE b0641 JW0636 Rare lipoprotein B rlpB protein protein ecoli Escherichia coli (strain K12) MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN DIP protein P0ADC1 original sequence version: 77 DIP protein P0ADC1 original sequence version: 42 DIP protein P0ADC1 original sequence version: 62 C9387BC2008ADEDC lpta_ecoli Lipopolysaccharide export system protein LptA lptA b3200 JW3167 yhbN protein protein ecoli Escherichia coli (strain K12) MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN BA69198479C68DC1 lptd_ecoli LPS-assembly protein LptD lptD ostA b0054 yabG Organic solvent tolerance protein JW0053 imp protein protein ecoli Escherichia coli (strain K12) MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQNTL DIP protein P31554 original sequence version: 130 DIP protein P31554 original sequence version: 96 DIP protein P31554 original sequence version: 117 DIP protein P31554 original sequence version: null 906EA3FE8F8D3E1E lpta-lptc-1 2 6 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his 37 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range tyr 182 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ala 172 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2, S1, S2 lpta-lptd-1 2 6 unspecified role unspecified role neutral component neutral component val 163 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined asp 57 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys 60 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain tyr 63 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain lys 92 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain thr 53 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain phe 69 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2, S1 lpta-lpta 2 6 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his 37 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain val 163 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure S4A,B lpta-lptd-3 3 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Figure 3 lpta-lptd-5 2 7 unspecified role unspecified role neutral component neutral component P31554:p.[Cys31Ser;Cys173Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:57:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys31ser,cys173ser' Tue Jun 30 19:20:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys31Ser;Cys173Ser]' P31554:p.[Cys31Ser;Cys725Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:19:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys31ser,cys725ser' Tue Jun 30 15:36:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys31Ser;Cys725Ser]' 3 flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P31554:p.Cys724_Cys725delinsSerSer mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain CC SS Thu Jul 07 12:17:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys724_725ser Fri Jul 22 10:55:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys724ser,cys725ser' Wed May 02 20:15:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_cys724-725ser_ser' Tue Jun 30 17:07:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys724_Cys725delinsSerSer' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain The mutant without this region contains all four cysteine residues but fails to form native disulfide bonds because of a defect in interaction with LptE. region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Wild type LptD contains four cysteine (C) residues that form disulfide bonds (31,173,724,725). In each of these disrupting mutations two of the C were replaced with Ser (S). All these mutant variants couldn't be cross linked by LptA-His V163pBPA. Only the variant SCSC could be cross linked. These results show that native disulfide bonds are required for LptD to interact with LptA. 6 unspecified role unspecified role neutral component neutral component val 163 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4, S5 lpte-lptd 1 7 unspecified role unspecified role prey prey 3x flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4A, S5A