UniProt UniProt http://www.uniprot.org Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. J. Biol. Chem. (0021-9258) 2012 imex curation Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu Accepted 2013-DEC-09 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. J. Biol. Chem. (0021-9258) 2012 imex curation Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu Accepted 2013-DEC-09 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. J. Biol. Chem. (0021-9258) 2012 imex curation Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu Accepted 2013-DEC-09 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. J. Biol. Chem. (0021-9258) 2012 imex curation Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Martínez F.P., Tang Q. Cells have been treated with TPA for 12h or 48h. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu Accepted 2013-DEC-09 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA kbzip_hhv8p E3 SUMO-protein ligase K-bZIP K8 E3 SUMO-protein transferase K-bZIP protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC 69FE9D78A4BB4FEC hdac1-hdac2-4 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association 3a hdac1-hdac2-5 4 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 2c hdac1-hdac2-6 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 2f at late time of TPA treatment k8-pml 4 6 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 1i at early time of TPA treatment hdac2-hdac1-2 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association 3a k8-hdac1 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 3a k8-hdac2 3 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 4A and C A K8/K-bZIP lys158arg mutant form of K-bZIP which cannot be sumoylated also interacts. hdac2-k8 3 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association 4A and C A K8/K-bZIP lys158arg mutant form of K-bZIP which cannot be sumoylated also interacts. k8-hdac2-1 1 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 6D Interaction was not seen using transfected viral BACdLZ plasmid with a deleted C-terminal leucine-zipper domain (ccordinates not given). hdac2-k8-1 1 7 unspecified role unspecified role bait bait cell lysate cell lysate 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 6D Interaction was not seen using transfected viral BACdLZ plasmid with a deleted C-terminal leucine-zipper domain (ccordinates not given).