UniProt UniProt http://www.uniprot.org Disease-associated mutations prevent GPR56-collagen III interaction. Disease-associated mutations prevent GPR56-collagen III interaction. PLoS ONE 2012 mimix curation Luo R., Jin Z., Deng Y., Strokes N., Piao X. Human IgG Fc-tagged mouse GRP56(N) and human GPR56(N) fusion constructs have been used in a ligand-binding assay on E14.5 mouse cortex. xianhua.piao@childrens.harvard.edu 09-Aug-2013: Contacted by IntAct-Help. mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Luo R., Jin Z., Deng Y., Strokes N., Piao X. Human IgG Fc-tagged mouse GRP56(N) and human GPR56(N) fusion constructs have been used in a ligand-binding assay on E14.5 mouse cortex. xianhua.piao@childrens.harvard.edu Accepted 2013-AUG-01 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. PLoS ONE 2012 mimix curation Disease-associated mutations prevent GPR56-collagen III interaction. Disease-associated mutations prevent GPR56-collagen III interaction. PLoS ONE 2012 mimix curation Luo R., Jin Z., Deng Y., Strokes N., Piao X. Human IgG Fc-tagged mouse GRP56(N) and human GPR56(N) fusion constructs have been used in a ligand-binding assay on E14.5 mouse cortex. xianhua.piao@childrens.harvard.edu 09-Aug-2013: Contacted by IntAct-Help. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Luo R., Jin Z., Deng Y., Strokes N., Piao X. Human IgG Fc-tagged mouse GRP56(N) and human GPR56(N) fusion constructs have been used in a ligand-binding assay on E14.5 mouse cortex. xianhua.piao@childrens.harvard.edu Accepted 2013-AUG-01 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. PLoS ONE 2012 mimix curation co3a1_mouse Collagen alpha-1(III) chain Col3a1 protein protein mouse Mus musculus Mouse MMSFVQSGTWFLLTLLHPTLILAQQSNVDELGCSHLGQSYESRDVWKPEPCQICVCDSGSVLCDDIICDEEPLDCPNPEIPFGECCAICPQPSTPAPVLPDGHGPQGPKGDPGPPGIPGRNGDPGLPGQPGLPGPPGSPGICESCPTGGQNYSPQFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGAAAIAGVGGEKSGGFSPYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAEKKHVWFGESMNGGFQFSYGPPDLPEDVVDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPIIDIAPYDIGGPDQEFGVDIGPVCFL 2104EC27A886090B agrg1_human Adhesion G-protein coupled receptor G1 ADGRG1 G-protein coupled receptor 56 GPR56 Protein TM7XN1 TM7LN4 TM7XN1 UNQ540/PRO1083 protein protein human Homo sapiens Human MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI 801C8E62666A5155 agrg1_mouse Adhesion G-protein coupled receptor G1 Cyt28 G-protein coupled receptor 56 Gpr56 Adgrg1 Serpentine receptor cyt28 protein protein mouse Mus musculus Mouse MAVQVLRQMVYFLLSLFSLVQGAHSGSPREDFRFCGQRNQTQQSTLHYDQSSEPHIFVWNTEETLTIRAPFLAAPDIPRFFPEPRGLYHFCLYWSRHTGRLHLRYGKHDYLLSSQASRLLCFQKQEQSLKQGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHKVSHNASVDMCDLKKELQQLSRYLQHPQKAAKRPTAAFISQQLQSLESKLTSVSFLGDTLSFEEDRVNATVWKLPPTAGLEDLHIHSQKEEEQSEVQAYSLLLPRAVFQQTRGRRRDDAKRLLVVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVTNLSDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGSWSSAGCETVSRDTQTSCLCNHLTYFAVLMVSSTEVEATHKHYLTLLSYVGCVISALACVFTIAAYLCSRRKSRDYTIKVHMNLLSAVFLLDVSFLLSEPVALTGSEAACRTSAMFLHFSLLACLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSIVGWGFPVFLVTLVALVDVNNYGPIILAVRRTPERVTYPSMCWIRDSLVSYVTNLGLFSLVFLFNLAMLATMVVQILRLRPHSQNWPHVLTLLGLSLVLGLPWALVFFSFASGTFQLVILYLFSIITSFQGFLIFLWYWSMRFQAQGGPSPLKNNSDSAKLPISSGSTSSSRI B5315D70B66C9A9A col3a1-gpr56 1 3 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 1D, F, 2, 4 gpr56-col3a1 2 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q8K209:p.Arg38Trp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R W Wed May 02 17:06:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg38trp' Tue Jun 30 18:02:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg38Trp' Q8K209:p.Arg38Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 15:08:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg38gln' Tue Jun 30 18:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg38Gln' Q8K209:p.Tyr88Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 20:15:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88cys' Tue Jun 30 16:09:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Cys' Q8K209:p.Cys91Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:32:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys91ser' Tue Jun 30 19:44:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys91Ser' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3 unspecified role unspecified role prey prey mouse-fibroblast Mus musculus fibroblast Fibroblast physical association physical association 2K, 3F, 4F col3a1-gpr56-1 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9Y653:p.Arg38Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 19:37:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg38gln' Tue Jun 30 19:54:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg38Gln' Q9Y653:p.Cys91Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:57:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys91ser' Tue Jun 30 16:13:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys91Ser' Q9Y653:p.Tyr88Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 15:07:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88cys' Tue Jun 30 19:44:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Cys' 3 unspecified role unspecified role neutral component neutral component colocalization colocalization 6C-F gpr56-col3a1-1 2 4 unspecified role unspecified role bait bait Q9Y653:p.Arg38Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 17:18:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg38gln' Tue Jun 30 17:53:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg38Gln' Q9Y653:p.Tyr88Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 16:05:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88cys' Tue Jun 30 19:59:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Cys' UniProt FTId: VAR_026243 Q9Y653:p.Cys91Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:42:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys91ser' Tue Jun 30 18:35:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys91Ser' UniProt FTId: VAR_026244 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey direct interaction direct interaction 6B