UniProt UniProt http://www.uniprot.org Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. J. Biol. Chem. (0021-9258) 2012 imex curation Heo J.B., Sung S., Assmann S.M. sma3@psu.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Heo J.B., Sung S., Assmann S.M. sma3@psu.edu Accepted 2013-JUL-05 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. J. Biol. Chem. (0021-9258) 2012 imex curation Heo J.B., Sung S., Assmann S.M. sma3@psu.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Heo J.B., Sung S., Assmann S.M. sma3@psu.edu Accepted 2013-JUL-05 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. J. Biol. Chem. (0021-9258) 2012 imex curation Heo J.B., Sung S., Assmann S.M. sma3@psu.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Heo J.B., Sung S., Assmann S.M. sma3@psu.edu Accepted 2013-JUL-05 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. J. Biol. Chem. (0021-9258) 2012 imex curation Heo J.B., Sung S., Assmann S.M. sma3@psu.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Heo J.B., Sung S., Assmann S.M. sma3@psu.edu Accepted 2013-JUL-05 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation gbb_arath Guanine nucleotide-binding protein subunit beta GB1 T4L20.40 At4g34460 transducin AGB1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWAFGGHRRVI DIP protein P49177 original sequence version: 63 06673A2F707A2F44 xlg2_arath Extra-large guanine nucleotide-binding protein 2 XLG2 Extra-large GTP-binding protein 2 F10M10.160 At4g34390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAVIRKLLPFPSPNPKRDNRESDDDDETSSGYRIEYSFASEYKGPLIANVPRALPVEVDQIPTALPVSFSSLRSGISYPVAPLVMTKDTKRPPDSGIEKKNGFVDSAAGSSVVLIGRDVVSGSSSSSSSKRLDVPEEVKSPADFRLSPSSPLSASAREEDHLDDDRVSDVGPRAVRFVEPFQSSECDESSYVSDGESIAATHRAERKGKRGSCYRCQLGNRFTEKEVCIVCDAKYCFNCVRRAMGAMPEGRKCQACIGYRIDESKRASLGKCSRMLKRHLTDSELRQVMNAEITCKANQLPSRLIIVNDKPLSEDELYTLQTCPNPPKKLKPGHYWYDKVAGYWGKIGEKPSQIISPNNSIGGYISEKVSNGDTEIYINGREITKPELTMLKWAGVQCEGKPHFWVDSDGSYREEGQKHPIGNIWSKKRAKIACAVFSLPVPPASSAVEPYDVPLYEQKMLNKLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQSSGNVGDETSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQATYKRLRDTLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESLESDYQHDTDMKYQLIRLNPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLATKQLFENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTCEWFEDFNPLISQNQTSRHNPPMAQRAFHYIGYKFKRLYDSILEPVNMRGRSFKPKLFVCQVSLESDTVDNALRYAREILKWHVEETSMFQEMSTTSIEASSSS E1D9D723224166CF rem19_arath B3 domain-containing protein REM19 REM19 RTV1 Protein RELATED TO VERNALIZATION 1 Protein REPRODUCTIVE MERISTEM 19 F13F21.8 At1g49480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQMDSAQNQFNKRARLFEDPELKDAKVIYPSNPESTEPVNKGYGGSTAIQSFFKESKAEETPKVLKKRGRKKKNPNPEEVNSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAAKTFEPTNPYFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAGRAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFVLEVTAFRVNEYV CB902C811E446A67 gg1_arath Guanine nucleotide-binding protein subunit gamma 1 GG1 AGG1 Ggamma-subunit 1 Heterotrimeric G protein gamma-subunit 1 MAA21.50 At3g63420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MREETVVYEQEESVSHGGGKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNLGWDRWFEGPNGGEGCRCLIL F032D1883E59538B xlg2-rtv1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association xlg2-rtv1 4 6 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C6KIE6:p.Thr476Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 18:55:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr476asn' Tue Jun 30 19:10:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr476Asn' 7 unspecified role unspecified role prey prey physical association physical association Fig. 3A agg1-agb1 4 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 3A rtv1-xlg2 2 6 unspecified role unspecified role prey prey c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C6KIE6:p.Thr476Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:37:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr476asn' Tue Jun 30 16:27:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr476Asn' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3B xlg2-rtv1-1 3 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4