UniProt UniProt http://www.uniprot.org Cofactor mobility determines reaction outcome in the IMPDH and GMPR (β-α)8 barrel enzymes. Cofactor mobility determines reaction outcome in the IMPDH and GMPR (β-α)8 barrel enzymes. Nat. Chem. Biol. (1552-4450) 2011 imex curation Patton G.C., Stenmark P., Gollapalli D.R., Sevastik R., Kursula P., Flodin S., Schuler H., Swales C.T., Eklund H., Himo F., Nordlund P., Hedstrom L. par.nordlund@ki.se 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Patton G.C., Stenmark P., Gollapalli D.R., Sevastik R., Kursula P., Flodin S., Schuler H., Swales C.T., Eklund H., Himo F., Nordlund P., Hedstrom L. par.nordlund@ki.se Accepted 2013-DEC-05 by ORCHARD Nat. Chem. Biol. (1552-4450) 2011 imex curation imp IMP 2'-inosine-5'-monophosphate 5'-IMP 5'-Inosinate 5'-Inosine monophosphate 5'-Inosinic acid hypoxanthosine 5'-monophosphate IMP Inosine 5'-monophosphate Inosine 5'-phosphate Inosine monophosphate inosinic acid Inosinic acid ribosylhypoxanthine monophosphate 5'-inosinic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) GRSZFWQUAKGDAV-KQYNXXCUSA-N GRSZFWQUAKGDAV-KQYNXXCUSA-N nadph NADPH dihydronicotinamide-adenine dinucleotide phosphate NADPH NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE reduced nicotinamide-adenine dinucleotide phosphate TPNH 2'-O-phosphonoadenosine 5'-{3-[1-(3-carbamoyl-1,4-dihydropyridin-1-yl)-1,4-anhydro-D-ribitol-5-yl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ACFIXJIJDZMPPO-NNYOXOHSSA-N ACFIXJIJDZMPPO-NNYOXOHSSA-N gmpr2_human GMP reductase 2 Guanosine 5'-monophosphate oxidoreductase 2 GMPR2 protein protein human Homo sapiens Human MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC E7812A754C433E51 gmpr2-imp-1 1 2 unspecified role unspecified role unspecified role unspecified role 3 unspecified role unspecified role unspecified role unspecified role 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction suppl. fig 6b 1.70 A R-factor: 0.165, R-free: 0.206 gmpr2-imp-2 1 2 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction suppl. fig 6 2.15 A R-factor: 0.161, R-free: 0.210