IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Type VI adenylyl cyclase regulates neurite extension by binding to Snapin and Snap25. Type VI adenylyl cyclase regulates neurite extension by binding to Snapin and Snap25. Mol. Cell. Biol. (0270-7306) 2011 imex curation Wu C.S., Lin J.T., Chien C.L., Chang W.C., Lai H.L., Chang C.P., Chern Y. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I can find no mention of myc-snapin any where else in this publication nor in the 3 references given (12, 30,67) mouse hippocampal neurons Intact does not include interactions of artificial chimeric proteins such as Flag/Fc-AC6-N5.(Ref 30) bmychern@ibms.sinica.edu.tw 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-neuro_2_a Mus musculus albino neuroblastoma cell line neuro 2 a (N2a) neuro_2_a Mouse Albino neuroblastoma neuro 2 a cell line pull down pull down western blot western blot Immuno blot Immuno blot Wu C.S., Lin J.T., Chien C.L., Chang W.C., Lai H.L., Chang C.P., Chern Y. Parkinsons - Interactions investigated in the context of Parkinsons disease I can find no mention of myc-snapin any where else in this publication nor in the 3 references given (12, 30,67) mouse hippocampal neurons Intact does not include interactions of artificial chimeric proteins such as Flag/Fc-AC6-N5.(Ref 30) bmychern@ibms.sinica.edu.tw. bmychern@ibms.sinica.edu.tw Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60879 original sequence version: 38 DIP protein P60879-1 original sequence version: 41 DIP protein P60879-1 original sequence version: 109 DIP protein P60879-1 original sequence version: 81 DIP protein P60879 original sequence version: 111 FBED2B082A4CB6A6 snapn_mouse SNARE-associated protein Snapin Snapin Snap25bp Snapap Synaptosomal-associated protein 25-binding protein Biogenesis of lysosome-related organelles complex 1 subunit 7 Bloc1s7 protein protein mouse Mus musculus Mouse MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK C81AC2ABCDCA21FA adcy6_rat Adenylate cyclase type 6 Adcy6 ATP pyrophosphate-lyase 6 Adenylate cyclase type VI Adenylyl cyclase 6 Ca(2+)-inhibitable adenylyl cyclase protein protein rat Rattus norvegicus (Rat) Rat MSWFSGLLVPKVDERKTAWGERNGQKRPRQATRARGFCAPRYMSCLKNVEPPSPTPAARTRCPWQDEAFIRRAGPGRGVKLGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRLAQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPALPQPAYVALLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSAGLWCPVFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWHLNNGDPFLWKQLGANVVLFLCTNAIGVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNGYLKEQCIETFLILGASQKRKEEKAMLVKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKENRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQFLVFPHSALILGIYAGIFLLLLVTVLICAVCSCGSFFPNALQRLSRSIVRSRVHSTAVGVFSVLLVFISAIANMFTCSHTPLRTCAARMLNLTPSDVTACHLRQINYSLGLEAPLCEGTAPTCSFPEYFVGSVLLSLLASSVFLHISSIGKLVMTFVLGFIYLLLLLLGPPATIFDNYDLLLSVHGLASSNETFDGLDCPAVGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS 5042C650546E4E79 adcy6-snap25 1 2 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey Q9Z266:p.Ser50Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:06:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser50ala' Tue Jun 30 18:19:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser50Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B Snapin S50A, which had no interaction with Snap25, prevented the pulldown of Snap25 by Fc-AC6. adcy6-snap25-1 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role prey prey association association 7A