UniProt UniProt http://www.uniprot.org MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. Traffic (1398-9219) 2012 mimix curation Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu 28-Oct_2013: Contacted by IntAct-Help. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Accepted 2013-OCT-17 by MGT 28-Oct_2013: Contacted by IntAct-Help. Traffic (1398-9219) 2012 mimix curation MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. Traffic (1398-9219) 2012 mimix curation Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu 28-Oct_2013: Contacted by IntAct-Help. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag visualisation tag visualisation Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Accepted 2013-OCT-17 by MGT 28-Oct_2013: Contacted by IntAct-Help. Traffic (1398-9219) 2012 mimix curation MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. Traffic (1398-9219) 2012 mimix curation Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu 28-Oct_2013: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Accepted 2013-OCT-17 by MGT 28-Oct_2013: Contacted by IntAct-Help. Traffic (1398-9219) 2012 mimix curation rab10_human Ras-related protein Rab-10 RAB10 protein protein human Homo sapiens Human MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC 7F02B8E8E46EE1E8 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 rab35_human Ras-related protein Rab-35 Ras-related protein Rab-1C GTP-binding protein RAY RAB35 RAB1C RAY protein protein human Homo sapiens Human MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC 31EB15D6D42E076E milk1_human MICAL-like protein 1 MICALL1 KIAA1668 MIRAB13 Molecule interacting with Rab13 protein protein human Homo sapiens Human MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS 755E3B57C6037292 micall1-rab35 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association fig 4A rab35-micall1 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association fig 4C rab10-micall1 3 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association fig 4C arf6-rab8a 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 5 arf6-micall1 1 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association fig 6H