IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the maltose transporter in a pretranslocation intermediate state. Crystal structure of the maltose transporter in a pretranslocation intermediate state. Science (0036-8075) 2011 imex curation Oldham M.L., Chen J. chenjue@purdue.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Oldham M.L., Chen J. chenjue@purdue.edu Accepted 2013-JAN-24 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Science (0036-8075) 2011 Only protein-protein interactions imex curation amp-pnp AMP-PNP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) malf_ecoli Maltose/maltodextrin transport system permease protein MalF malF b4033 JW3993 protein protein ecoli Escherichia coli (strain K12) MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD DIP protein P02916 original sequence version: 123 DIP protein P02916 original sequence version: 114 895CEA1986CE5C0B malk_ecoli Maltose/maltodextrin import ATP-binding protein MalK malK b4035 JW3995 protein protein ecoli Escherichia coli (strain K12) MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV DIP protein P68187 original sequence version: 98 DIP protein P68187 original sequence version: 87 240D58F59450F30E malg_ecoli Maltose/maltodextrin transport system permease protein MalG JW3992 b4032 malG protein protein ecoli Escherichia coli (strain K12) MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG DIP protein P68183 original sequence version: 76 DIP protein P68183 original sequence version: 67 E54418E91E344A29 male_ecoli Maltose/maltodextrin-binding periplasmic protein malE MMBP Maltodextrin-binding protein Maltose-binding protein JW3994 b4034 protein protein ecoli Escherichia coli (strain K12) MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK DIP protein P0AEX9 original sequence version: 88 DIP protein P0AEX9 original sequence version: 77 A4C1B3C1777ADE47 maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) male-malfgk2 wt complex 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig.s 2c, 3, S1, S2, S4-S6, S8 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains wild-type malE and the nonhydrolysable ATP analog, AMP-PNP. male-malfgk2 mt co-1 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component P0AEX9:p.Ser363Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 14:38:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser363cys' Tue Jun 30 18:16:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser363Cys' P0AEX9:p.Gly95Cys mutation mutation certain certain sequence position certain certain certain sequence position certain G C Wed May 02 18:29:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly95cys' Tue Jun 30 19:35:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly95Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig.s 2b, 3b, S6, S8 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains malE mutant and the nonhydrolysable ATP analog, AMP-PNP. male-malfgk2 mt co-2 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0AEX9:p.Ser363Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Wed May 02 17:03:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser363cys' Tue Jun 30 17:40:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser363Cys' P0AEX9:p.Gly95Cys mutation mutation certain certain sequence position certain certain certain sequence position certain G C Wed May 02 19:42:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly95cys' Tue Jun 30 20:07:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly95Cys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig.s 2b, 3a, S1, S2, S4, S5 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains malE mutant.