UniProt UniProt http://www.uniprot.org A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. Plant J. (0960-7412) 2011 imex curation Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu Accepted 2013-FEB-14 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Plant J. (0960-7412) 2011 Only protein-protein interactions imex curation A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. Plant J. (0960-7412) 2011 imex curation Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu Accepted 2013-FEB-14 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Plant J. (0960-7412) 2011 Only protein-protein interactions imex curation A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. A critical role of autophagy in plant resistance to necrotrophic fungal pathogens. Plant J. (0960-7412) 2011 imex curation Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lai Z., Wang F., Zheng Z., Fan B., Chen Z. zhixiang@purdue.edu Accepted 2013-FEB-14 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Arabidopsis HybridZAP-2.1 two-hybrid cDNA library was prepared from Arabidopsis plants harvested 4 h after spraying with 2 mm salicylic acid Plant J. (0960-7412) 2011 Only protein-protein interactions imex curation at18a_arath Autophagy-related protein 18a ATG18A PEUP2 Protein PEROXISOME UNUSUAL POSITIONING 2 F26K9_200 At3g62770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATVSSSSWPNPNPNPDSTSASDSDSTFPSHRDRVDEPDSLDSFSSMSLNSDEPNQTSNQSPLSPPTPNLPVMPPPSVLHLSFNQDHACFAVGTDRGFRILNCDPFREIFRRDFDRGGGVAVVEMLFRCNILALVGGGPDPQYPPNKVMIWDDHQGRCIGELSFRSDVRSVRLRRDRIIVVLEQKIFVYNFSDLKLMHQIETIANPKGLCAVSQGVGSMVLVCPGLQKGQVRIEHYASKRTKFVMAHDSRIACFALTQDGHLLATASSKGTLVRIFNTVDGTLRQEVRRGADRAEIYSLAFSSNAQWLAVSSDKGTVHVFGLKVNSGSQVKDSSRIAPDATPSSPSSSLSLFKGVLPRYFSSEWSVAQFRLVEGTQYIAAFGHQKNTVVILGMDGSFYRCQFDPVNGGEMSQLEYHNCLKPPSVF D99D2E757C22189C wrk33_arath Probable WRKY transcription factor 33 WRKY33 At2g38470 T19C21.4 WRKY DNA-binding protein 33 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASFLTMDNSRTRQNMNGSANWSQQSGRTSTSSLEDLEIPKFRSFAPSSISISPSLVSPSTCFSPSLFLDSPAFVSSSANVLASPTTGALITNVTNQKGINEGDKSNNNNFNLFDFSFHTQSSGVSAPTTTTTTTTTTTTTNSSIFQSQEQQKKNQSEQWSQTETRPNNQAVSYNGREQRKGEDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLEGQITEIVYKGSHNHPKPQSTRRSSSSSSTFHSAVYNASLDHNRQASSDQPNSNNSFHQSDSFGMQQEDNTTSDSVGDDEFEQGSSIVSRDEEDCGSEPEAKRWKGDNETNGGNGGGSKTVREPRIVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHDVPAARGSGYATNRAPQDSSSVPIRPAAIAGHSNYTTSSQAPYTLQMLHNNNTNTGPFGYAMNNNNNNSNLQTQQNFVGGGFSRAKEEPNEETSFFDSFMP A90A6A8A2DF56DB1 wrky33-atatg18a 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association atatg18a-wrky33 1 4 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1a wrky33-atatg18a-1 3 5 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1b