IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. J. Mol. Biol. (0022-2836) 2010 imex curation Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk Accepted 2013-NOV-26 by MGT J. Mol. Biol. (0022-2836) 2010 Only protein-protein interactions imex curation Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. J. Mol. Biol. (0022-2836) 2010 imex curation Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk Accepted 2013-NOV-26 by MGT J. Mol. Biol. (0022-2836) 2010 Only protein-protein interactions imex curation Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. J. Mol. Biol. (0022-2836) 2010 imex curation Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Filippakopoulos P., Low A., Sharpe T.D., Uppenberg J., Yao S., Kuang Z., Savitsky P., Lewis R.S., Nicholson S.E., Norton R.S., Bullock A.N. rnorton@wehi.edu.au,alex.bullock@sgc.ox.ac.uk Accepted 2013-NOV-26 by MGT J. Mol. Biol. (0022-2836) 2010 Only protein-protein interactions imex curation spsb1_human SPRY domain-containing SOCS box protein 1 SSB1 SPSB1 protein protein human Homo sapiens Human MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ F93D5690A32403DF spsb4_human SPRY domain-containing SOCS box protein 4 SPSB4 SSB4 protein protein human Homo sapiens Human MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ 234A651A08217489 spsb4_mouse SPRY domain-containing SOCS box protein 4 Spsb4 Ssb4 protein protein mouse Mus musculus Mouse MGQKLSGSLKSVEVREPALRPAKRELRGLEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATARAPLHSVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYLQYQ DIP protein Q8R5B6 original sequence version: 33 623749B6F8C31B22 pawr_human PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein PAWR PAR4 protein protein human Homo sapiens Human MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR DIP protein Q96IZ0 original sequence version: 31 DIP protein Q96IZ0 original sequence version: 110 7E7515455402DBF8 spsb2_mouse SPRY domain-containing SOCS box protein 2 Spsb2 Grcc9 Ssb2 Gene-rich cluster protein C9 protein protein mouse Mus musculus Mouse MGQTALARGSSSTPTSQALYSDFSPPEGLEELLSAPPPDLVAQRHHGWNPKDCSENIDVKEGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQADHYAALLGSNSESWGWDIGRGKLYHQSKGLEAPQYPAGPQGEQLVVPERLLVVLDMEEGTLGYSIGGTYLGPAFRGLKGRTLYPSVSAVWGQCQVRIRYMGERRVEEPQSLLHLSRLCVRHALGDTRLGQISTLPLPPAMKRYLLYK DIP protein O88838 original sequence version: 41 E71985597D9B38CB spsb2_human SPRY domain-containing SOCS box protein 2 SPSB2 GRCC9 SSB2 Gene-rich cluster protein C9 protein protein human Homo sapiens Human MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ 0729EDDD0B598665 vasa1_drome ATP-dependent RNA helicase vasa vas Antigen Mab46F11 vasa CG46283 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDDWDDEPIVDTRGARGGDWSDDEDTAKSFSGEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGGRREGERDFRGGEGGFRGGQGGSRGGQGGSRGGQGGFRGGEGGFRGRLYENEDGDERRGRLDREERGGERRGRLDREERGGERGERGDGGFARRRRNEDDINNNNNIVEDVERKREFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSNQNFGGVDVRGRGNYVGDATNVEEEEQWD 8617C25CCB3130B9 spsb1_mouse SPRY domain-containing SOCS box protein 1 Spsb1 Ssb1 protein protein mouse Mus musculus Mouse MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ DIP protein Q9D5L7 original sequence version: 38 2CBA3B50A3240177 pawr-spsb1 1 4 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 16 14 direct interaction direct interaction Table 3 1.79A working 19.2%, free 23.9% spsb1-vas 1 4 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 10 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 19 21 direct interaction direct interaction Table 3 2.05A working 18.0%, free 23.2% spsb2-vas 1 9 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 10 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 27 25 direct interaction direct interaction Table 3 1.80A working 17.8%, free 21.6% pawr-spsb2 3 8 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 30 33 direct interaction direct interaction Fig. 1 pawr-spsb2-1 3 8 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 36 39 direct interaction direct interaction Fig. 2 pawr-spsb1-1 2 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 44 42 direct interaction direct interaction Table 2 Temp = 20C spsb1-vas-1 2 10 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 49 47 direct interaction direct interaction Table 2 Temp = 20C pawr-spsb2-2 2 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 52 54 direct interaction direct interaction Table 2 Temp = 20C spsb2-vas-1 2 9 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 10 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 59 57 direct interaction direct interaction Table 2 Temp = 20C pawr-spsb4 2 5 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 64 62 direct interaction direct interaction Table 2 Temp = 20C spsb4-vas 2 10 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 69 67 direct interaction direct interaction Table 2 Temp = 20C pawr-spsb2-3 2 8 unspecified role unspecified role neutral component neutral component O88838:p.Val206Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 14:54:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val206ala' Tue Jun 30 15:52:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val206Ala' b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O88838:p.Tyr120Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:09:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr120ala' Tue Jun 30 17:21:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr120Ala' O88838:p.Leu123_Gly125delinsAlaAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LLG AAA Thu Jul 07 12:17:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu123ala-leu124ala-gly125ala Fri Jul 22 10:57:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu123ala,leu124ala,gly125ala' Wed May 02 20:29:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu_gly123-125ala_ala_ala' Tue Jun 30 18:38:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu123_Gly125delinsAlaAlaAla' O88838:p.Ser126_Ser128delinsAlaAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain SNS AAA Thu Jul 07 12:17:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser126ala-asn127ala-ser128ala Fri Jul 22 10:55:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser126ala,asn127ala,ser128ala' Wed May 02 14:33:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_asn_ser126-128ala_ala_ala' Tue Jun 30 18:25:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser126_Ser128delinsAlaAlaAla' ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q96IZ0:p.Asn72Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:24:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn72ala' Tue Jun 30 19:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn72Ala' ecobd Escherichia coli (strain B / BL21-DE3) 73 78 direct interaction direct interaction Table 1 Temp = 22C pawr-spsb1-2 2 11 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component lig_spry_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96IZ0:p.Asn70Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 17:04:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn70ala' Tue Jun 30 19:25:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn70Ala' Q96IZ0:p.Asn71Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 14:24:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn71ala' Tue Jun 30 16:36:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn71Ala' Q96IZ0:p.Glu68_Leu69delinsAspIle mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain EL DI Thu Jul 07 12:16:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu68asp-leu69ile Fri Jul 22 10:51:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu68asp,leu69ile' Wed May 02 20:01:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_leu68-69asp_ile' Tue Jun 30 17:15:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu68_Leu69delinsAspIle' chemical synthesis Chemical synthesis (Chemical synthesis) 84 82 direct interaction direct interaction Table 1 Temp = 22C The glu68asp-leu69ile mutation increases the affinity to Kd = 40 +/- 5 x 10E-9 molar. pawr-spsb4-1 2 7 unspecified role unspecified role neutral component neutral component Q96IZ0:p.Asn72Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:59:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn72ala' Tue Jun 30 18:38:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn72Ala' lig_spry_1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 6 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range ecobd Escherichia coli (strain B / BL21-DE3) 93 91 direct interaction direct interaction Table 1 Temp = 22C pawr-spsb2-4 2 8 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component Q96IZ0:p.Asn71Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:34:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn71ala' Tue Jun 30 18:27:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn71Ala' lig_spry_1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q96IZ0:p.Glu68Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E D Wed May 02 15:07:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu68asp' Tue Jun 30 15:37:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu68Asp' Q96IZ0:p.Leu69Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L I Wed May 02 17:43:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69ile' Tue Jun 30 20:03:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Ile' Q96IZ0:p.Asn70Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:54:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn70ala' Tue Jun 30 17:42:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn70Ala' Q96IZ0:p.Glu68_Leu69delinsAspIle mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain EL DI Thu Jul 07 12:18:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu68asp-leu69ile Fri Jul 22 10:52:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu68asp,leu69ile' Wed May 02 16:22:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_leu68-69asp_ile' Tue Jun 30 19:15:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu68_Leu69delinsAspIle' chemical synthesis Chemical synthesis (Chemical synthesis) 96 99 direct interaction direct interaction Table 1 Temp = 22C The glu68asp and leu69ile mutations increase the affinity of this peptide to Kd = 106 +/- 30 x 10E-9 molar (for glu68asp-leu69ile); Kd = 208 +/- 13 x 10E-9 molar (for glu68asp); and Kd = 1.6 +/- 0.4 x 10E-6 molar (for leu69ile). pawr-spsb4-2 2 6 unspecified role unspecified role neutral component neutral component b30.2/spry domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component Q96IZ0:p.Glu68_Leu69delinsAspIle mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain EL DI Thu Jul 07 12:06:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu68asp-leu69ile Fri Jul 22 11:13:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu68asp,leu69ile' Wed May 02 15:38:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_leu68-69asp_ile' Tue Jun 30 18:03:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu68_Leu69delinsAspIle' Q96IZ0:p.Asn70Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 18:16:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn70ala' Tue Jun 30 17:08:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn70Ala' lig_spry_1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q96IZ0:p.Asn71Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:04:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn71ala' Tue Jun 30 19:34:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn71Ala' Q96IZ0:p.Glu68Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E D Wed May 02 19:36:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu68asp' Tue Jun 30 16:39:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu68Asp' Q96IZ0:p.Leu69Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L I Wed May 02 14:51:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69ile' Tue Jun 30 16:35:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Ile' chemical synthesis Chemical synthesis (Chemical synthesis) 110 106 direct interaction direct interaction Table 1 Temp = 22C The glu68asp and leu69ile mutations increase the affinity of this peptide to Kd = 33 +/- 23 x 10E-9 molar (for glu68asp-leu69ile); Kd = 47 +/- 22 x 10E-9 molar (for glu68asp); and Kd = 55 +/- 8 x 10E-9 molar (for leu69ile).