UniProt UniProt http://www.uniprot.org Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. J. Biol. Chem. (0021-9258) 2010 imex curation Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. J. Biol. Chem. (0021-9258) 2010 imex curation Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. J. Biol. Chem. (0021-9258) 2010 imex curation Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. J. Biol. Chem. (0021-9258) 2010 imex curation Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation sut12_arath Sulfate transporter 1.2 SULTR1;2 F28K19.22 At1g78000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRAHPVDGSPATDGGHVPMKPSPTRHKVGIPPKQNMFKDFMYTFKETFFHDDPLRDFKDQPKSKQFMLGLQSVFPVFDWGRNYTFKKFRGDLISGLTIASLCIPQDIGYAKLANLDPKYGLYSSFVPPLVYACMGSSRDIAIGPVAVVSLLLGTLLRAEIDPNTSPDEYLRLAFTATFFAGITEAALGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVLESVFKAAHHGWNWQTILIGASFLTFLLTSKIIGKKSKKLFWVPAIAPLISVIVSTFFVYITRADKQGVQIVKHLDQGINPSSFHLIYFTGDNLAKGIRIGVVAGMVALTEAVAIGRTFAAMKDYQIDGNKEMVALGMMNVVGSMSSCYVATGSFSRSAVNFMAGCQTAVSNIIMSIVVLLTLLFLTPLFKYTPNAILAAIIINAVIPLIDIQAAILIFKVDKLDFIACIGAFFGVIFVSVEIGLLIAVSISFAKILLQVTRPRTAVLGNIPRTSVYRNIQQYPEATMVPGVLTIRVDSAIYFSNSNYVRERIQRWLHEEEEKVKAASLPRIQFLIIEMSPVTDIDTSGIHALEDLYKSLQKRDIQLILANPGPLVIGKLHLSHFADMLGQDNIYLTVADAVEACCPKLSNEV B019CADDD9ADED46 cysk1_arath Cysteine synthase 1 OASA1 OAS1 OASS At.OAS.5-8 CSase A Cys-3A O-acetylserine sulfhydrylase Beta-substituted Ala synthase 1;1 O-acetylserine (thiol)-lyase 1 OLD3 Protein ONSET OF LEAF DEATH 3 dl3480c At4g14880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA 5B3E7F3D9DA5908B sut11_arath Sulfate transporter 1.1 SULTR1;1 HST1 AST101 High-affinity sulfate transporter 1 Hst1At T3F12.7 At4g08620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGTINPPDGGGSGARNPPVVRQRVLAPPKAGLLKDIKSVVEETFFHDAPLRDFKGQTPAKKALLGIQAVFPIIGWAREYTLRKFRGDLIAGLTIASLCIPQDIGYAKLANVDPKYGLYSSFVPPLIYAGMGSSRDIAIGPVAVVSLLVGTLCQAVIDPKKNPEDYLRLVFTATFFAGIFQAGLGFLRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKTFTKKTDIVSVMHSVFKNAEHGWNWQTIVIGASFLTFLLVTKFIGKRNRKLFWVPAIAPLISVIISTFFVFIFRADKQGVQIVKHIDQGINPISVHKIFFSGKYFTEGIRIGGIAGMVALTEAVAIARTFAAMKDYQIDGNKEMIALGTMNVVGSMTSCYIATGSFSRSAVNFMAGVETAVSNIVMAIVVALTLEFITPLFKYTPNAILAAIIISAVLGLIDIDAAILIWRIDKLDFLACMGAFLGVIFISVEIGLLIAVVISFAKILLQVTRPRTTVLGKLPNSNVYRNTLQYPDAAQIPGILIIRVDSAIYFSNSNYVRERASRWVREEQENAKEYGMPAIRFVIIEMSPVTDIDTSGIHSIEELLKSLEKQEIQLILANPGPVVIEKLYASKFVEEIGEKNIFLTVGDAVAVCSTEVAEQQT 248521A19E1B7AB4 sultr1_2-oasa1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association sultr1_2-oasa1-1 1 5 unspecified role unspecified role bait bait stas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 14 physical association physical association Fig. 1B sultr1_1-oasa1 1 7 unspecified role unspecified role bait bait stas sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain weak interaction 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 19 physical association physical association Fig. 1A oasa1-sultr1_2 4 6 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range stas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A, 2B, S1, S2 O-acetylserine oasa1-sultr1_2-1 4 6 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf physical association physical association Fig. 2C oasa1-oasa1 3 6 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C sultr1_2-sultr1_2 1 5 unspecified role unspecified role bait bait lstas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey lstas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 42 40 physical association physical association Fig. 1A, S2 oasa1-sultr1_2-3 3 6 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3B sultr1_2-sultr1_2-1 3 5 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 5 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 54 51 physical association physical association Fig. 3E