IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease BAS1800 is not wt-autoradiograpy but I cannot find out if it might be autoradiography - simpler to leave in "predetermined". (the machines seem to be sold with beta + gamma counters, but I cannot detemin if a scintillant or film is used or not - it uses an "imaging plate") Participant detection was by autoradiography and/or using a BAS1800 (Fuji) imaging plate. kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease An anti-phospho-Ser9 synapsin I antibody purchased from PhosphoSolutions was used - this antibody would appear to also bind to synapsin 2- this molecule also has a serine at S9 and a similar sequence at this site. kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions danre-brain Danio rerio brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Heat-inactivated synaptosomes which had been pre-treated with or without lambda-phosphatase were phosphorylated by zDCLK(377–677). kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay tag visualisation tag visualisation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Results showing phosphorylation of MLC(Myosin Light Chain) by Rat CaMKI and histones by DCLK(377–677) have not been shown as the origin of MLC is not given and identity and origin of histones is not known. kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. Identification of an endogenous substrate of zebrafish doublecortin-like protein kinase using a highly active truncation mutant. J. Biochem. (0021-924X) 2010 imex curation Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. kamesita@ag.kagawa-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay sequence tag sequence tag identification sequence tag Shimomura S., Nagamine T., Hatano N., Sueyoshi N., Kameshita I. Parkinsons - Interactions investigated in the context of Parkinsons disease Heat treated Zebrafish brain extract was used to ensure inactivation of endogenous zDCLK. Fractions were separated by Iso-electic focusing prior to zDCLK(377–677) phosphorylation. kamesita@ag.kagawa-u.ac.jp Accepted 2013-DEC-13 by PPORRAS J. Biochem. (0021-924X) 2010 Only protein-protein interactions imex curation syntide_2_peptide Syntide-2 synthetic peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PLARTLSVAGLPGKK An amino acid sequence which is not represented in UniProt The native peptide PLARTLSVAGLPGKK is a selective Substrate for CaM kinase II and PKC. it is also a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. CBB20424AD7344D2 c5nu62_danre syn2b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MNFLRRRLSDSSFIANLPNGYMSDLQRPDPPPPPPADAKPPSGSPAAPLAPAENRSPSSSPAPERRPQPAPSSGSGFFSSITNVVKQTAASAGLVEQSPATASRKFKILLVIDEPQNDWTKLFRGKKVQGDYDIKVEQAEFSEINLVAHANGTCSVDMQVIRNGTKVVRSFKPDFVLVRQHAYSMAQNEDFRNIIIGLQYAGIPSVNSLESIYNLCDKPWAFAQLISVYKKMGPEKFPLVDQTFYSNYRDMISMPTFPVVVKIGHAHSGMGKVKVDNHSDFQDIASVVAITQTYTTTEPFIDAKYDIRVQKIGFDYKAYMRTSISGNWKSNTGSAMLEQVAMTDKYKLWVDTCADVFGGLEICAVKAIHGKDGKDYITEVVGSSMPLIGEHQMEDRQLITAIVLAKMNHESSRTSVCAQQRPAATVQPAQSPALKESLPEPIKTPGQRPPPQGGAVKPQEPQPKSQEPTPEPVPAQEPVPKAGPTPTLPPTTQQPKPQTQAAPEPTPGKPTDLPPKPQPPKPLPPKPVPPVRRNSKPQIQPKPQTPPPAKALPKADTDQDPGQIKPDSVPAQEQSPARVPIKPPSPAKPQLQPKPVLREQAKPEARAQPAAPSEAASAPDRATSAPAPAPAPAQPPVEEQPAPQQKSSHPLLNKSQSLTNAFNAFGDTFRSSNEDEAKAETIRNLRKSFASLFSD 83240F83F2EC478E mbp_bovin Myelin basic protein MBP Myelin A1 protein 20 kDa microtubule-stabilizing protein protein protein bovin Bos taurus (Bovine) Bovine AAQKRPSQRSKYLASASTMDHARHGFLPRHRDTGILDSLGRFFGSDRGAPKRGSGKDGHHAARTTHYGSLPQKAQGHRPQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGLKGHDAQGTLSKIFKLGGRDSRSGSPMARR DIP protein P02687 original sequence version: 75 8E1157B7A1978484 creb1_rat Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 protein protein rat Rattus norvegicus (Rat) Rat MTMDSGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD D6D715DEED679FF2 a2a121_danre dclk2a dclk2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSSRNIEWEHFEEREKGHRSPRGSGGSHSGSRGNGIVPSPAHSAHCSFYRTRTLQSLTSEKKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNWSVNVKTGASRSMPSLTATKNELRERESKDYIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACGPEKYRYAQDDFVLDHSGKASTAFITECQVIKSSYSARSAPPVRYSGSKSPGTGRRSKSPGSARRTAGHFSTNSQSPVKSPINGAPNSQITTPKSAKSSSSSPTSPRSMRNFKIPTHHSSAGNVNGSSETPQHHNNSLSPEVNGNRNLAASTILDKYKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWVTEDAAMENNMKMEVAGKLKKHFNSVQKQSNTSAGVSVIMNTALDKETIQLSHRRQDRNPPRPEKRPSSTNPERRRSNRGRSSVQSEDSRSAAPIEPATSANPSAPAALPSDPSPQFHECNTESEASKDLLKEE F2564F0F6244F946 kcc1a_rat Calcium/calmodulin-dependent protein kinase type 1 Camk1 CaM kinase I CaM kinase I alpha protein protein rat Rattus norvegicus (Rat) Rat MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPTAGGPAAGCCCRDCCVEPGSELPPAPPPSSRAMD Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes like transcriptional regulation, hormone production, translational regulation, regulation of actin filament organization and neurite outgrowth. Involved in calcium-dependent activation of the ERK pathway (By similarity). Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CTFR, MYL9, SYN1/synapsin I and SYNII/synapsin II mint 37889B3DEF033AB2 b0uxi4_danre Synapsin I syn1 si:dkey-90n12.3 Synapsin-1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MNYLRRRLSDSNFMSNLPNGYMGDLQRPDPPQQSPAPVLSPGSQERRQPAPSQSTGAGFFSSISNAVKQTTAAAAATFNEATERGIGSGNAKILLVIDDQQTDWAKVFKGKKVHGDCDIKVEQADFSEVNLVAHATGSYSVDIEAIRSGNKITKCIKPDFVLVRQHAFSMAKNGDHRNIVIGLQYAGLPSVNSLHSVYNFCDKPWVFSQLSRLYKQLGPEEFPLIDQVYYPNHKEMITTPGFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDIRIQKIGENYKAYMRTSISGNWKTNTGSAMLEQVAMSDRYRMWVDVCSEVFGGLDICAVEALHGKDGRDYIIEVVGCSMPLIGDQQDEDRALMADLVVAKMNETVPRTSAPTTVRSQGPAVSPQPISQSRVPQAQQRPPPQGGPQQAAASTAATRQGAPPQQRPSPQGQPPAQSQSVTSPIAQNPPAQQPRPNQPPQRQASQGSAAPQRPPAAQIPAQRGSPQSQRQGGPQQGGPQTGGQSPKPAGQPQQRPQQPRQGQPTRQPTQGGPQQTQDAPQPAPQGSPRPPTTQQPRPTAPGQGGPGGTRPPLQQKPQPPQKPSPDHPALSGSPQLNKSQSLTNTFNIPETPAAQHQSPSQDEAKAETIRNLRKSFASLFSVE 331CB0AF43106A70 dclk2-mbp 7 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component bovin-brain Bos taurus brain brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 1C, 2B, 3A/B P02687 phosres dclk2-dclk2 7 11 enzyme target enzyme target substrate substrate neutral component neutral component bovin-brain Bos taurus brain brain Brain [cerebrum] 13 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 inhibitor inhibitor neutral component neutral component c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 2B P02687 phosres dclk2-dclk2-1 7 14 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range possible_phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 inhibitor inhibitor neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component bovin-brain Bos taurus brain brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 2Bi, 3B P02687 phosres Vector used Rat for CamKI alpha was pET-23a+ - which has an optional C term His tag - not stated if there is one or not, but have added it as imidazole is in the buffer for column washing, -so His tag most likely present. (? maybe the "+" means the optional tag is present??) A2A121 decreases activity of Q63450. The inhibitory polypeptide, zDCLK(678–810), showed weak inhibition of CaMKI. camk1-dclk2 7 14 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range possible_phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate neutral component neutral component probable_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3B P15337 phosres Vector used for RatCREB was pET - which may or may not have His tag - it is not stated if there is one or not, but have added it as imidazole is in the buffer -in the original reference (17) only - for column washing, -so His tag most likely present. dclk2-mbp-3 8 13 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component danre-brain Danio rerio brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 4 C5NU62 phosres dclk2-syn2b 2 10 enzyme target enzyme target substrate substrate neutral component neutral component c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5B C5NU62 phosres vector for synpasin 2 is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-syn2b-1 2 15 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5Bi B0UXI4 phosres vector for synpasin 1a is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-mbp-4 2 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component bovin-brain Bos taurus brain brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 1D P02687 phosres dclk2-syn2b-2 3 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5C C5NU62 ser-9 O-phospho-L-serine vector for synpasin 2 is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-syn1 3 15 enzyme target enzyme target substrate substrate neutral component neutral component c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5C B0UXI4 ser-9 O-phospho-L-serine vector for synpasin 1a is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-syn2b-3 7 13 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C5NU62:p.Ser9Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:46:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser9ala' Tue Jun 30 20:14:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser9Ala' C5NU62:p.Ser58Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:52:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Tue Jun 30 20:05:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5D, 8B(RHS) C5NU62 ser-9 O-phospho-L-serine C5NU62 ser-58 O-phospho-L-serine vector for synpasin 2 is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-syn2b-4 1 13 unspecified role unspecified role bait bait kinase_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6B dclk2-syn1-1 4 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 7B dclk2-syn2b-5 5 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate neutral component neutral component danre-brain Danio rerio brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 8B A2A121 phosres dclk2-syn2b-6 5 15 enzyme target enzyme target substrate substrate neutral component neutral component danre-brain Danio rerio brain Brain [cerebrum] 13 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 8Bi A2A121 phosres dclk2-syn1-2 7 13 enzyme enzyme neutral component neutral component kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 15 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 8B (RHS) B0UXI4 phosres vector for synpasin 1a is derived form pET23+ - imidazole is in buffer used to elute from column, so presumably His tag is present. dclk2-1 7 13 putative self putative self putative self putative self n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true 1C, 3A, 4A A2A121 phosres camk1-dclk2-1 7 14 enzyme enzyme neutral component neutral component possible_phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component bovin-brain Bos taurus brain brain Brain [cerebrum] phosphorylation phosphorylation reaction phosphorylation 2Bi, 3Bi P02687 phosres Vector used Rat for CamKI alpha was pET-23a+ - which has an optional C term His tag - not stated if there is one or not, but have added it as imidazole is in the buffer for column washing, -so His tag most likely present. (? maybe the "+" means the optional tag is present??) A2A121decreases activity of Q63450. The inhibitory polypeptide, zDCLK(678–810), showed weak inhibition of CaMKI. dclk2-mbp-5 6 13 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation 1E syntide-2 phosres