mbinfo MBInfo http://www.mechanobio.info/ Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. J. Cell Biol. (0021-9525) 2009 imex curation Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-mtln3 Rat mammary adenocarcinoma mtln3 Rat mammary adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu Accepted 2013-MAR-20 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. J. Cell Biol. (0021-9525) 2009 imex curation Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu Accepted 2013-MAR-20 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. J. Cell Biol. (0021-9525) 2009 imex curation Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-mtln3 Rat mammary adenocarcinoma mtln3 Rat mammary adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu Accepted 2013-MAR-20 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. J. Cell Biol. (0021-9525) 2009 imex curation Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-mtln3 Rat mammary adenocarcinoma mtln3 Rat mammary adenocarcinoma fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret immunostaining immunostaining Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu Accepted 2013-MAR-20 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. Cortactin regulates cofilin and N-WASp activities to control the stages of invadopodium assembly and maturation. J. Cell Biol. (0021-9525) 2009 imex curation Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-mtln3 Rat mammary adenocarcinoma mtln3 Rat mammary adenocarcinoma fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Oser M., Yamaguchi H., Mader C.C., Bravo-Cordero J.J., Arias M., Chen X., Desmarais V., van Rheenen J., Koleske A.J., Condeelis J. Interaction detection: FRET acceptor photobleaching. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. The FRET experiments from Fig S4(C,D) could not be curated since the source of GFP-cofilin could not be identified. The cortactin-Nck1 colocalization experiments (Fig 7C) could not be curated since the source of GFP-Nck1 could not be identified. moser@aecom.yu.edu Accepted 2013-MAR-20 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation actb_rat Actin, cytoplasmic 1 Actb Beta-actin protein protein rat Rattus norvegicus (Rat) Rat MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 6AFD05CA94E360E2 b2rz33_rat Cytoplasmic protein Nck1 Nck1_predicted rCG_25905 protein protein rat Rattus norvegicus (Rat) Rat MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS 6D28AD5870A89C29 cofa_dicdi Cofilin-1A cofA cof1 dcof1 DDB_G0277833 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSSGIALAPNCVSTFNDLKLGRKYGGIIYRISDDSKEIIVDSTLPAGCSFDEFTKCLPENECRYVVLDYQYKEEGAQKSKICFVAWCPDTANIKKKMMATSSKDSLRKACVGIQVEIQGTDASEVKDSCFYEKCTKI 0C0B0673354F46F3 cof1_rat Cofilin-1 Cofilin, non-muscle isoform Cfl1 protein protein rat Rattus norvegicus (Rat) Rat MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL 19835391A81A5AB2 src8_rat Src substrate cortactin Cttn protein protein rat Rattus norvegicus (Rat) Rat MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQTPPASPSPQPAEDRPPSSPIYEDAAPLKAEPSYGSSEPEPEYSTEAAGLPEASNQQGLAYTSEPVYETTEVPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 059CDB52681E2592 src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q60598 original sequence version: 136 DIP protein Q60598 original sequence version: 78 DIP protein Q60598 original sequence version: 135 8F5CA026ACCD6D4F wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E cfl1-cttn-1 4 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 5A, 5B. The FRET efficiency was increased in starved MLTn3 cells, decreased 1 min after EGF stimulation and increased again after 5 min of EGF stimulation (Fig 5B). cfl1-cttn-3 4 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component Q60598:p.[Tyr421Glu;Tyr466Glu;Tyr482Glu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 18:36:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr421glu,tyr466glu,tyr482glu' Tue Jun 30 19:09:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr421Glu;Tyr466Glu;Tyr482Glu]' proximity proximity close-contact colocalization neighbourhood interaction Fig 5C. cfl1-cttn-5 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig 5D, 5E. Cortactin coprecipitation by cofilin was decreased in the presence of EGF stimulation. Cofilin did not interact with phosphorylated cortactin. cttn-cfl1 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 5F, 5G The amount of cofilin coprecipitated by cortactin decreased in the presence of EGF stimulation. cfl1-cttn-7 1 11 unspecified role unspecified role prey prey Q60598:p.[Tyr421Phe;Tyr466Phe;Tyr482Phe] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:40:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr421phe,tyr466phe,tyr482phe' Tue Jun 30 18:40:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr421Phe;Tyr466Phe;Tyr482Phe]' 9 unspecified role unspecified role bait bait physical association physical association Fig 5H, 5I. Cortactin 3YF mutant coprecipitated increased levels of cofilin, when compared to WT cortactin, suggesting that cofilin interacts chiefly with dephosphorylated cortactin. cttn-cofa 2 11 unspecified role unspecified role bait bait Q60598:p.[Tyr421Phe;Tyr466Phe;Tyr482Phe] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:07:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr421phe,tyr466phe,tyr482phe' Tue Jun 30 19:13:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr421Phe;Tyr466Phe;Tyr482Phe]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold direct interaction direct interaction Fig 6A, 6B. The recombinant cofilin had a higher affinity for the 3YF cortactin mutant, when compared to the WT cortactin, as inferred from the Kd values. The Kd value for the cofilin-cortactin WT interaction was 3.5+/_ 1.1 micromoles and the Kd value for the cofilin-cortactin 3YF mutant was 2.8+/_ 0.34 micromoles. actb-cfl1-1 4 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 6F, 6G. The FRET efficiency between cofilin and beta-actin increased in the presence of EGF stimulation. nck1-cttn 1 10 unspecified role unspecified role prey prey tyr421 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain Required phosphorylation 7 unspecified role unspecified role bait bait physical association physical association Fig 7E. Nck1 coprecipitated phosphorylated cortactin as detected by anti-phospho antibody. Nck1 did not coprecipitate non-phosphorylated cortactin. cttn-cfl1-2 3 10 unspecified role unspecified role bait bait Q66HL2:p.[Leu421Phe;Gly466Phe;Glu482Phe] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L F certain certain sequence position certain certain certain sequence position certain G F certain certain sequence position certain certain certain sequence position certain E F Wed May 02 17:48:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu421phe,gly466phe,glu482phe' Tue Jun 30 20:05:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu421Phe;Gly466Phe;Glu482Phe]' region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association Fig S5(B,C). wasl-1 5 12 unspecified role unspecified role self self n-terminal region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range self interaction self interaction true Fig 7F, 7G. The intramolecular interaction within N-Wasp was decreased in MTLn3 cells expressing 3YF cortactin, but not in cells expressing WT cortactin.