mbinfo MBInfo http://www.mechanobio.info/ An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. J. Cell. Sci. (0021-9533) 2009 imex curation Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. FRET experiments (Fig. 3,4,5,7, S2 and S3) and coimmunoprecipitation experiments (Fig 6C) involving recombinant integrin alpha-4 or integrin alpha-5/alpha-4 chimera could not be curated since the source of integrin alpha-4 was not specified and could not be identified. martin.humphries@manchester.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. martin.humphries@manchester.ac.uk Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2009 Only protein-protein interactions imex curation An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. J. Cell. Sci. (0021-9533) 2009 imex curation Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. FRET experiments (Fig. 3,4,5,7, S2 and S3) and coimmunoprecipitation experiments (Fig 6C) involving recombinant integrin alpha-4 or integrin alpha-5/alpha-4 chimera could not be curated since the source of integrin alpha-4 was not specified and could not be identified. martin.humphries@manchester.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. martin.humphries@manchester.ac.uk Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2009 Only protein-protein interactions imex curation 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 p130cas_crigr_protein p130Cas protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster g3gu78_crigr I79_001232 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKLLLLVTLLTARAIAQNISLQAVWQFGNAFECILPLPVPTKEYTAYGCYCGLSSWIPFLEDLDPCCRARDNCYAQVDYLGNCALLIRNPYTSSYSYSCSGTEITCSDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQETAVPPPVPPPPSSEALNGTILDPLDQWQPSGSRYTHQQPPSPSPVYSSSAKTSGASNPQDSALCSRAGEEEHVYSFPNKHKSAEPSPTMMSSSLGNNLSELDRLLLELNAVQHNPSGFPAESNSTLGGKTGPLMKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKTSSSAVVLSSQGLLPSSTPFLPITLLHPPPPTKFSHGGHTPMVLNREGNSQVLLPSGAPRRLDLVSLKGTSGTPNSWCPSGEGSQQSFGAKSQAQVRNDLTDSMTKPFQTPLCHTLHPAVSTGSQGPLASYVCSEETVAPVERWPQAVPGSRPEIPPGVTYSIQEGTEPAVMAVDRQAVLPDTWSLTKECGQQERAQSEPEGLESSCPAPANEEQLGGKIPWRGSLGGPTQALENPRNPEGATKATLEARKEEPEFPHAGVMGTPNTSERISTAGQAGSSLCSH 474A0FA9FF21C85B g3hvn3_crigr I79_015011 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MEHIQGAWKSISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPASSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF E55EDD67B23E9C26 g3hkz1_crigr I79_011374 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIEAELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN E3BFAF3F306969EA ywhaz-g3gu78 2 4 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 3 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig 6A. g3gu78-g3hkz1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig 6B. ywhaz-raf1-1 2 6 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 3 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig 6C. Though integrin alpha-4/alpha-5 mutants were also precipitated with 14-3-3 zeta, the interaction could not be curated since the source of integrin alpha-4 was not specified and could not be identified.