IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. Molecular dynamism of Fe-S cluster biosynthesis implicated by the structure of the SufC(2)-SufD(2) complex. J. Mol. Biol. (0022-2836) 2009 imex curation Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wada K., Sumi N., Nagai R., Iwasaki K., Sato T., Suzuki K., Hasegawa Y., Kitaoka S., Minami Y., Outten F.W., Takahashi Y., Fukuyama K. ytaka@molbiol.saitama-u.ac.jp,fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 2009 Only protein-protein interactions imex curation sufb_ecoli FeS cluster assembly protein SufB ynhE sufB b1683 JW5273 protein protein ecoli Escherichia coli (strain K12) MSRNTEATDDVKTWTGGPLNYKEGFFTQLATDELAKGINEEVVRAISAKRNEPEWMLEFRLNAYRAWLEMEEPHWLKAHYDKLNYQDYSYYSAPSCGNCDDTCASEPGAVQQTGANAFLSKEVEAAFEQLGVPVREGKEVAVDAIFDSVSVATTYREKLAEQGIIFCSFGEAIHDHPELVRKYLGTVVPGNDNFFAALNAAVASDGTFIYVPKGVRCPMELSTYFRINAEKTGQFERTILVADEDSYVSYIEGCSAPVRDSYQLHAAVVEVIIHKNAEVKYSTVQNWFPGDNNTGGILNFVTKRALCEGENSKMSWTQSETGSAITWKYPSCILRGDNSIGEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGANCGAHTFPYVECRNNSAQLEHEATTSRIGEDQLFYCLQRGISEEDAISMIVNGFCKDVFSELPLEFAVEAQKLLAISLEHSVG DIP protein P77522 original sequence version: null 3BB49EEADB6C1278 sufc_ecoli Probable ATP-dependent transporter SufC ynhD sufC b1682 JW1672 protein protein ecoli Escherichia coli (strain K12) MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWLTEQQ DIP protein P77499 original sequence version: null 78FB1108E1850DF9 sufd_ecoli FeS cluster assembly protein SufD ynhC sufD b1681 JW1671 protein protein ecoli Escherichia coli (strain K12) MAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTGLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGRYVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGAR DIP protein P77689 original sequence version: null 5744291F1E0AE825 sufc-sufd-1 6 8 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.s 1a, 1b, 2, 3c, 4a R = 0.23; Rwork = 0.23; Rfree = 0.26 2.2 A sufc-sufd-2 4 8 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1c sufc-sufd-3 1 8 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P77499:p.Tyr86Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 16:40:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr86cys' Tue Jun 30 16:34:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr86Cys' ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3d Tyr86 was mutated to Cyc to enhance SufC homodimer interface binding in the presence of ATP and metal ions (Mg2+, Cu2+). It produced an additional, larger band on the native gel than the WT complex suggesting a conformational change in the complex quaternary structure. I didn't give the stoichiometry here as the authors don't give the size of the bands, they just assume that it is the same heterotetramer they found by x-ray and EM. sufd-1 3 9 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4c sufd-sufbc 2 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4d sufc-sufd-4 3 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5a sufbcd-1 3 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 5a sufbcd-2 5 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 5b sufd-sufc-2 5 8 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5b