IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro decarboxxylation assay decarboxylation assay decarboxxylation assay predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. This experiment is described in detail in PMID:19019160. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. The oxidoreductase assay with purified Gdh/dhe2 is described in detail in PMID:19019160. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis. Sci Signal 2009 imex curation Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. stephen.smerdon@nimr.mrc.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Nott T.J., Kelly G., Stach L., Li J., Westcott S., Patel D., Hunt D.M., Howell S., Buxton R.S., O'Hare H.M., Smerdon S.J. Gara peptides used in itc experiments contained an additional YKK tripeptide at their C-termini to enhance solubility. stephen.smerdon@nimr.mrc.ac.uk Accepted 2013-NOV-25 by MGT Sci Signal 2009 Only protein-protein interactions imex curation nadh Nicotinamide adenine dinucleotide, reduced form small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) kgd_myctu Multifunctional 2-oxoglutarate metabolism enzyme kgd 2-hydroxy-3-oxoadipate synthase 2-oxoglutarate carboxy-lyase 2-oxoglutarate decarboxylase Alpha-ketoglutarate decarboxylase Alpha-ketoglutarate-glyoxylate carboligase Rv1248c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSQPAAEPTRVTSPLVAERAAAAAPQAPPKPADTAAAGNGVVAALAAKTAVPPPAEGDEVAVLRGAAAAVVKNMSASLEVPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEVDGKPTAVTPAHTNLGLAIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIAELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSIPYLPVRWSTDNPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFRSHPDLEVLTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKHVKPTVAQQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVSLTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPYVYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLVRLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVYDSPLSEYAAVGFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQGPDHTSARIERFLQLWAEGSMTIAMPSTPSNYFHLLRRHALDGIQRPLIVFTPKSMLRHKAAVSEIKDFTEIKFRSVLEEPTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLAIVRLEQLAPLPRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIKRISRRAMSAPSSGSSKVHAVEQQEILDEAFG 96C255612BA12889 dhe2_myctu NAD-specific glutamate dehydrogenase gdh NAD(+)-dependent glutamate dehydrogenase Rv2476c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTIDPGAKQDVEAWTTFTASADIPDWISKAYIDSYRGPRDDSSEATKAAEASWLPASLLTPAMLGAHYRLGRHRAAGESCVAVYRADDPAGFGPALQVVAEHGGMLMDSVTVLLHRLGIAYAAILTPVFDVHRSPTGELLRIEPKAEGTSPHLGEAWMHVALSPAVDHKGLAEVERLLPKVLADVQRVATDATALIATLSELAGEVESNAGGRFSAPDRQDVGELLRWLGDGNFLLLGYQRCRVADGMVYGEGSSGMGVLRGRTGSRPRLTDDDKLLVLAQARVGSYLRYGAYPYAIAVREYVDGSVVEHRFVGLFSVAAMNADVLEIPTISRRVREALAMAESDPSHPGQLLLDVIQTVPRPELFTLSAQRLLTMARAVVDLGSQRQALLFLRADRLQYFVSCLVYMPRDRYTTAVRMQFEDILVREFGGTRLEFTARVSESPWALMHFMVRLPEVGVAGEGAAAPPVDVSEANRIRIQGLLTEAARTWADRLIGAAAAAGSVGQADAMHYAAAFSEAYKQAVTPADAIGDIAVITELTDDSVKLVFSERDEQGVAQLTWFLGGRTASLSQLLPMLQSMGVVVLEERPFSVTRPDGLPVWIYQFKISPHPTIPLAPTVAERAATAHRFAEAVTAIWHGRVEIDRFNELVMRAGLTWQQVVLLRAYAKYLRQAGFPYSQSYIESVLNEHPATVRSLVDLFEALFVPVPSGSASNRDAQAAAAAVAADIDALVSLDTDRILRAFASLVQATLRTNYFVTRQGSARCRDVLALKLNAQLIDELPLPRPRYEIFVYSPRVEGVHLRFGPVARGGLRWSDRRDDFRTEILGLVKAQAVKNAVIVPVGAKGGFVVKRPPLPTGDPAADRDATRAEGVACYQLFISGLLDVTDNVDHATASVNPPPEVVRRDGDDAYLVVAADKGTATFSDIANDVAKSYGFWLGDAFASGGSVGYDHKAMGITARGAWEAVKRHFREIGIDTQTQDFTVVGIGDMSGDVFGNGMLLSKHIRLIAAFDHRHIFLDPNPDAAVSWAERRRMFELPRSSWSDYDRSLISEGGGVYSREQKAIPLSAQVRAVLGIDGSVDGGAAEMAPPNLIRAILRAPVDLLFNGGIGTYIKAESESDADVGDRANDPVRVNANQVRAKVIGEGGNLGVTALGRVEFDLSGGRINTDALDNSAGVDCSDHEVNIKILIDSLVSAGTVKADERTQLLESMTDEVAQLVLADNEDQNDLMGTSRANAASLLPVHAMQIKYLVAERGVNRELEALPSEKEIARRSEAGIGLTSPELATLMAHVKLGLKEEVLATELPDQDVFASRLPRYFPTALRERFTPEIRSHQLRREIVTTMLINDLVDTAGITYAFRIAEDVGVTPIDAVRTYVATDAIFGVGHIWRRIRAANLPIALSDRLTLDTRRLIDRAGRWLLNYRPQPLAVGAEINRFAAMVKALTPRMSEWLRGDDKAIVEKTAAEFASQGVPEDLAYRVSTGLYRYSLLDIIDIADIADIDAAEVADTYFALMDRLGTDGLLTAVSQLPRHDRWHSLARLAIRDDIYGALRSLCFDVLAVGEPGESSEQKIAEWEHLSASRVARARRTLDDIRASGQKDLATLSVAARQIRRMTRTSGRGISG B8ED8C54C24CCFAA 2-oxoglutarate(2-) 2-oxoglutarate(2-) 2-ketoglutarate 2-oxoglutarate 2-oxopentanedioic acid, ion(2-) alpha-ketoglutarate 2-oxopentanedioate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) KPGXRSRHYNQIFN-UHFFFAOYSA-L KPGXRSRHYNQIFN-UHFFFAOYSA-L gltb_myctu Glutamate synthase [NADPH] large chain gltB Glutamate synthase subunit alpha Rv3859c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTPKRVGLYNPAFEHDSCGVAMVVDMHGRRSRDIVDKAITALLNLEHRGAQGAEPRSGDGAGILIQVPDEFLREAVDFELPAPGSYATGIAFLPQSSKDAAAACAAVQKIAEAEGLQVLGWRSVPTDDSSLGALSRDAMPTFRQVFLAGASGMALERRCYVVRKRAEHELGTKGPGQDGPGRETVYFPSLSGQTLVYKGMLTTPQLKAFYLDLQDERLTSALGIVHSRFSTNTFPSWPLAHPFRRIAHNGEINTVTGNENWMRAREALIKTDIFGSAADVEKLFPICTPGASDTARFDEVLELLHLGGRSLAHAVLMMIPEAWERHESMDPARRAFYQYHASLMEPWDGPASMTFTDGTVVGAVLDRNGLRPSRIWVTDDGLVVMASEAGVLDLHPSTVVRRMRLQPGRMFLVDTAQGRIVSDEEIKADLAAEHPYQEWLDNGLVPLDELPEGKDVRMPHHRIVMRQLAFGYTYEELNLLVAPMARLGAEPIGSMGTDTPVAVLSQRPRMLYDYFHQLFAQVTNPPLDAIREEVVTSLQGTTGGERDLLNPDQNSCHQIVLPQPILRNHELAKLVSLDPNDKVNGRPHGLRSKVIRCLYRVSEGGAGLAAALEEVRGAAAAAIADGARIIILSDRESDEEMAPIPSLLAVAGVHHHLVRERTRTQVGLVVESGDAREVHHMAALVGFGAAAINPYLVFESIEDMLDRGVIEGIDRTAALNNYIKAAGKGVLKVMSKMGISTLASYTGAQLFQAVGISEQVLDEYFTGLTCPTGGITLDDIAADVAARHRLAYLDRPDERAHRELEVGGEYQWRREGEYHLFNPETVFKLQHSTRTGQYKIFKEYTRLVDDQSERMASLRGLLKFRTGVRPPVPLDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGARSNCGEGGEDVKRFDRDPNGDWRRSAIKQVASARFGVTSHYLTNCTDLQIKMAQGAKPGEGGQLPGHKVYPWVAEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPSARVHVKLVSENGVGTVAAGVSKAHADVVLISGHDGGTGATPLTSMKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQLKTGRDVMIATLLGAEEFGFATAPLVVAGCIMMRVCHLDTCPVGVATQNPLLRERFTGKPEFVENFFMFIAEEVREYLAQLGFRTVNEAVGQAGALDTTLARAHWKAHKLDLAPVLHEPESAFMNQDLYCSSRQDHGLDKALDQQLIVMSREALDSGKPVRFSTTIGNVNRTVGTMLGHELTKAYGGQGLPDGTIDITFDGSAGNSFGAFVPKGITLRVYGDANDYVGKGLSGGRIVVRPSDDAPQDYVAEDNIIGGNVILFGATSGEVYLRGVVGERFAVRNSGAHAVVEGVGDHGCEYMTGGRVVILGRTGRNFAAGMSGGVAYVYDPDGELPANLNSEMVELETLDEDDADWLHGTIQVHVDATDSAVGQRILSDWSGQQRHFVKVMPRDYKRVLQAIALAERDGVDVDKAIMAAAHG 7ADAB46904A3AE46 gara_myctu Glycogen accumulation regulator GarA MTCY1A11.16c Rv1827 garA protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDMNPDIEKDQTSDEVTVETTSVFRADFLSELDAPAQAGTESAVSGVEGLPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPKQGEDDGSTGGP DIP protein P9WJA9 original sequence version: 12 18B1C42151ED0CCA pknb_myctu Serine/threonine-protein kinase PknB pknB MTCY10H4.14c Rv0014c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSAAGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ 6C27EEBE9D5A453B 6C27EEBE9D5A453B gara-kgd 5 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:11:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 19:19:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' P9WJA9:p.Asn117Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 20:00:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 20:00:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:11:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 19:14:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' fha_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 9 unspecified role unspecified role prey prey myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) physical association physical association Fig. 1b, Fig. 5c, Suppl. Fig. S1 gara-gltb 5 12 unspecified role unspecified role prey prey myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 13 unspecified role unspecified role bait bait fha_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P9WJA9:p.Ser95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:05:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser95ala' Tue Jun 30 18:28:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser95Ala' P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:40:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 20:08:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P9WJA9:p.Asn117Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 20:20:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 19:40:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 physical association physical association Fig. 1b, Fig. 5c, Suppl. Fig. S1 gara-gdh-9 5 13 unspecified role unspecified role bait bait thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 fha_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:32:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 20:11:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:14:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 18:25:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P9WJA9:p.Ser95Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:45:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser95ala' Tue Jun 30 19:19:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser95Ala' 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 10 unspecified role unspecified role prey prey myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) physical association physical association Fig. 1b, Fig. 5c, Suppl. Fig. S1 gara-gara-3 7 13 unspecified role unspecified role neutral component neutral component lig_fha_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain thr21 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role neutral component neutral component fha_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 44 48 direct interaction direct interaction Suppl. Fig. S2, Suppl. Table S2 Temp = 20C, pH = 8.0 Gara peptide (residues 16-28) phosphorylated at thr21 bound to full length Gara with Kd = 22.8 x 10E-6 molar and to Gara-fha (residues 55-149) with Kd = 9.6 x 10E-6 molar. Gara peptide (residues 16-28) phosphorylated at thr22 bound to full length Gara with Kd = 12.6 x 10E-6 molar and to Gara-fha (residues 55-149) with Kd = 4.2 x 10E-6 molar. kgd-gara 1 9 unspecified role unspecified role bait bait unknown Unknown 13 unspecified role unspecified role prey prey P9WJA9:p.Asn117Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 14:48:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 19:37:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:06:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 19:04:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:25:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 19:25:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 direct interaction direct interaction Fig 5c P64897 decreases activity of O50463 gdh-gara 1 13 unspecified role unspecified role prey prey P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:58:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 19:59:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 19:38:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 18:18:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' P9WJA9:p.Ser95Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:25:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser95ala' Tue Jun 30 16:12:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser95Ala' P9WJA9:p.Asn117Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:59:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 15:43:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 10 unspecified role unspecified role bait bait unknown Unknown direct interaction direct interaction Fig. 5c P64897 decreases activity of O53203 gara-gara-2 3 13 unspecified role unspecified role neutral component neutral component lig_fha_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 3, 4 gara-pknb-1 2 14 enzyme enzyme neutral component neutral component ser/thr_dual-sp_kinase_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown Unknown 13 enzyme target enzyme target substrate substrate neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 phosphorylation phosphorylation reaction phosphorylation Suppl. Fig. S3a P64897 thr-22 O-phospho-L-threonine P0A5S4 decreases activity of P64897 2_oxoglutarate_2__-gara 4 11 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 13 inhibitor inhibitor neutral component neutral component P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:50:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 15:43:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' fha_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 P9WJA9:p.Asn117Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:01:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 16:56:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:33:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 19:30:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 decarboxylation decarboxylation reaction decarboxylation Fig. 1c, Suppl. Fig. S6 2_oxoglutarate_2__-ammonium_chloride 6 8 cofactor cofactor coenzyme neutral component neutral component 11 enzyme target enzyme target substrate substrate neutral component neutral component 10 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 13 inhibitor inhibitor neutral component neutral component thr22 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain phosphorylation of thr22 P9WJA9:p.Arg143Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 14:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143glu' Tue Jun 30 16:16:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Glu' fha_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P9WJA9:p.Ser95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:04:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser95ala' Tue Jun 30 19:58:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser95Ala' P9WJA9:p.Lys141Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:53:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu' Tue Jun 30 19:19:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys141Glu' P9WJA9:p.Asn117Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 17:23:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn117ala' Tue Jun 30 19:56:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn117Ala' 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 redox reaction oxidoreductase activity electron transfer reaction redox reaction Fig. 1d, Suppl. Fig. S6 2_oxoglutarate_2__-gara-1 4 11 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) decarboxylation decarboxylation reaction decarboxylation Fig. 1c, Suppl. Fig. S6 2_oxoglutarate_2__-gara-2 6 11 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 cofactor cofactor coenzyme neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 10 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) redox reaction oxidoreductase activity electron transfer reaction redox reaction Fig. 1d, Suppl. Fig. S6