UniProt UniProt http://www.uniprot.org Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. Plant J. (0960-7412) 2009 imex curation Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. wen-hui.shen@ibmp-ulp.u-strasbg.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. Interactions containing Histone H2A cannot be annotated as the identity of the Histone involved cannot be found. wen-hui.shen@ibmp-ulp.u-strasbg.fr Accepted 2013-AUG-27 by MGT 09-Sep-2013: Contacted by IntAct-Help. Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. Plant J. (0960-7412) 2009 imex curation Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. wen-hui.shen@ibmp-ulp.u-strasbg.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. wen-hui.shen@ibmp-ulp.u-strasbg.fr Accepted 2013-AUG-27 by MGT 09-Sep-2013: Contacted by IntAct-Help. Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation as1_arath Transcription factor AS1 Protein ASYMMETRIC LEAVES 1 Myb-related protein 91 Protein PHANTASTICA AS1 MYB91 PHAN At2g37630 F13M22.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKERQRWSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVIRLQEKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQREEKESNKRVEPIDESKYDRILESFAEKLVKERSNVVPAAAAAATVVMANSNGGFLHSEQQVQPPNPVIPPWLATSNNGNNVVARPPSVTLTLSPSTVAAAAPQPPIPWLQQQQPERAENGPGGLVLGSMMPSCSGSSESVFLSELVECCRELEEGHRAWADHKKEAAWRLRRLELQLESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCRLDRP 24D9085193E6088B nap1d_arath Nucleosome assembly protein 1;4 NAP1;4 NFA4 Nucleosome/chromatin assembly factor group A4 MMM17.22 At3g13782 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNEENIKSDNKSGDSSDLPTIPALDIGAEECDLLAELKNLTLKRPFDVKKLSPKVTKRVLFLKDIQVTHDELEEKFLAEKSALEATYDNLYKPLFAKRYEIVNGVVEAEAEKEGVPNFWLIAMKTNEMLANEITERDEAALKYLKDIRSCRVEDTSRNFKLEFLFDSNLYFKNSVLSKTYHVNDEDGPVLEKVIGTDIEWFPGKCLTHKVVVKKKTKKGPKKVNNIPMTKTENCESFFNFFKPPEIPEIDEVDDYDDFDTIMTEELQNLMDQDYDIAVTIRDKLIPHAVSWFTGEALVDEDDSDDNDDDDNDEKSD FC86B7A67FE5CB0A as2_arath Protein ASYMMETRIC LEAVES 2 AS2 LBD6 LOB domain-containing protein 6 F5I14.15 At1g65620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSTNSPCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQIDLSCAKSELSKYQSLGILAATHQSLGINLLAGAADGTATAVRDHYHHHQFFPREQMFGGLDVPAGNNYDGGILAIGQITQFQQPRAAAGDDGRRTVDPS CF75859362F36686 nap1c_arath Nucleosome assembly protein 1;3 NAP1;3 NFA3 Nucleosome/chromatin assembly factor group A3 MHM17.6 At5g56950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTSALKDEDRAGLVNALKNKLQNLAGQHSDVLENLTPKIRRRVEVLREIQGKHDEIETKFREERAALEAKYQKLYQPLYNKRYEIVNGATEVEGAPEDAKMDQGDEKTAEEKGVPSFWLTALKNNDVISEEITERDEGALIYLKDIKWCKIEEPKGFKLEFFFDQNPYFKNTLLTKAYHMIDEDEPLLEKAIGTEIDWYPGKCLTQKILKKKPKKGAKNAKPITKTEDCESFFNFFNPPQVPDDDEDIDEERAEELQNLMEQDYDIGSTIREKIIPHAVSWFTGEAIEGEEFEIDNDDEDDIDEDEDEDEEDEDEDEEEDDEDEEEEVSKTKKKPSVLHKKGGRPQVTDDQQGERPPECKQQ 2B605ED9807A6343 nap1a_arath Nucleosome assembly protein 1;1 NAP1;1 NFA1 Nucleosome/chromatin assembly factor group A1 F20B18.220 At4g26110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ 8AA1C7E84C0BC4D2 nap1b_arath Nucleosome assembly protein 1;2 NAP1;2 NFA2 Nucleosome/chromatin assembly factor group A2 F3P11.8 At2g19480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSMNMSDLSTALNEEDRAGLVNALKNKLQNLAGQHSDVLENLTPPVRKRVEFLREIQNQYDEMEAKFFEERAALEAKYQKLYQPLYTKRYEIVNGVVEVEGAAEEVKSEQGEDKSAEEKGVPDFWLIALKNNEITAEEITERDEGALKYLKDIKWSRVEEPKGFKLEFFFDQNPYFKNTVLTKTYHMIDEDEPILEKALGTEIEWYPGKCLTQKILKKKPKKGSKNTKPITKTEDCESFFNFFSPPQVPDDDEDLDDDMADELQGQMEHDYDIGSTIKEKIISHAVSWFTGEAVEADDLDIEDDDDEIDEDDDEEDEEDDEDDEEEDDEDDDEEEEADQGKKSKKKSSAGHKKAGRSQLAEGQAGERPPECKQQ C5FAB1ABC318A8DC nap1;1-nap1;1 2 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 1a nap1;2-nap1;2 2 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;3-nap1;3 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;1-nap1;2 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;1-nap1;3 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 1a nap1;2-nap1;1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 1a nap1;2-nap1;3 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;3-nap1;1 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;3-nap1;2 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 1a nap1;1-nap1;4 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;2-nap1;4 2 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 1a nap1;3-nap1;4 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 1a nap1;2-nap1;2-1 1 8 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 8 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;2-nap1;3-1 1 6 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 8 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;2-nap1;4 1 8 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling physical association physical association Fig. 1b map1;1-nap1;2 1 8 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 7 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;1-nap1;3-1 1 6 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 7 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;1-nap1;4 1 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 7 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;3-nap1;2-1 1 6 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling physical association physical association Fig. 1b nap1;3-nap1;3-1 1 6 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 6 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;3-nap1;4 1 6 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling physical association physical association Fig. 1b nap1;4-nap1;2-1 1 8 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 4 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;4-nap1;3-1 1 6 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 4 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b nap1;4-nap1;4 1 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-seedling Arabidopsis thaliana seedling 4 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b as2-as1 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 1a