UniProt UniProt http://www.uniprot.org STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. J. Virol. (0022-538X) 2008 mimix curation Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu 17-Jun-2013: Contacted by IntAct-Help. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu Accepted 2013-MAY-30 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2008 mimix curation STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. J. Virol. (0022-538X) 2008 mimix curation Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu 17-Jun-2013: Contacted by IntAct-Help. human-2ftgh Human 2fTGH cells 2ftgh 2fTGH parental cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu Accepted 2013-MAY-30 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2008 mimix curation STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. J. Virol. (0022-538X) 2008 mimix curation Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu 17-Jun-2013: Contacted by IntAct-Help. human-u3a Homo sapiens STAT1 -/- fibrosarcma line u3a STAT1 -/- fibrosarcma line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu Accepted 2013-MAY-30 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2008 mimix curation STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. J. Virol. (0022-538X) 2008 mimix curation Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu 17-Jun-2013: Contacted by IntAct-Help. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu Accepted 2013-MAY-30 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2008 mimix curation stat1_human Signal transducer and activator of transcription 1-alpha/beta STAT1 Transcription factor ISGF-3 components p91/p84 protein protein human Homo sapiens Human MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV 054A813522364BA6 stat2_human Signal transducer and activator of transcription 2 p113 STAT2 protein protein human Homo sapiens Human MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKGPLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF DIP protein P52630 original sequence version: 116 E4C74674CB7A3215 v_measc Non-structural protein V P/V protein protein measc measles virus (strai MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPGQDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQASSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTLNVPPPPNPSRASTSETPIKKGHRREIGLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVCEQCRTDTGVDTRIWYHNLPEIPE DIP protein P0C774 original sequence version: 24 FEDBD36B65E382D0 p_v-stat1-1 4 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 2B and F, 3B, 4B p_v-stat1-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2C p_v-stat1-1 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 1C p_v-stat1-1 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1C